current user: public

If you have questions about the server, please let us know.

Query: IDP04122 putative aspartate/glutamate racemase [Yersinia pestis CO92] YPO2758 [Yersinia pestis CO92], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst MMKILGLIGGMSWESTIPYYRMINQHVKAQLGGLHSAKIILYSVDFHEIEQLQAKGDWQTAAQLLSNAAISLKHAGAEVIVVCTNTMHKVADDIEAACGLPLLHIADATAVQIKQQGIDKIGLLGTRYTMEQGFYRGRLTEKHGIEVITPDDTDREAVNRIIYEELCLGIISETSRDAYRRVIKKLEAQGVQGIIFGCTEITLLVNAQDASVPVFDTTAIHASAAADYALQLast
1 -100.000IDP04122 putative aspartate/glutamate racemase [Yersinia pestis CO92] YPO2758 [Yersinia pestis CO92]  ali  100  1MMKILGLIGGMSWESTIPYYRMINQHVKAQLGGLHSAKIILYSVDFHEIEQLQAKGDWQTAAQLLSNAAISLKHAGAEVIVVCTNTMHKVADDIEAACGLPLLHIADATAVQIKQQGIDKIGLLGTRYTMEQGFYRGRLTEKHGIEVITPDDTDREAVNRIIYEELCLGIISETSRDAYRRVIKKLEAQGVQGIIFGCTEITLLVNAQDASVPVFDTTAIHASAAADYALQ 231
2 -95.700IDP00877 gene: ygeA; putative racemase STM3015 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  57  1.MKTIGLLGGMSWESTIPYYRLINEGIKQQLGGLHSASLLLHSVDFHDIEVCQRRDEWDKAGDILAQAAHGLQQAGAEGIVLCTNTMHKIAHVIESRCSLPFLHIADATGRAIARQGLHRVALLGTRYTMEQDFYRGRLEQQFAIETIVPEADDRARINQVIFDELCQGTFTDASRHYYLQVIEQLAAQGAQGVIFGCTEIGLLVPQTQSALPVFDTTAIHAADAVSFMLS 230
3 -82.000IDP02135 putative aspartate racemase [Salmonella typhimurium LT2] STM4510 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  27  1MKHTIGILGGMGPAATADMLEKFVELRHASCDQQHIPLIVSSIPDIPDRTACLL-SGGPSPYRYLERYLHMLEDAGAECIVIPCNTAHYWFDDLQNVAKARMISILDATLGDIPPSA-RHVGLLATNATLATGLYQKKA-LARGLTLIQPEDAGQALVMQAIYTLKRGD--KTAAQALLLPQIDSLIARGAQAIIMGCTEIPLIVAGHEIACPMIDSTASLVRAAIRWYES 228
4 -25.200IDP00347 gene: racE; hypothetical protein lmo1237 lmo1237 [Listeria monocytogenes EGD-e]  ali follow..  17  1MKQAIGFVGGLT----------VVREVLKQLPHEQV-YYLGDTARCP-------PRDKEEVAKFTWEMTNFLVDRGIKMLVIACNTATAALYDIREKLDIPVIGVIQPGSRALKATRNNKIGVLGTLGTVESMAYPTA------LKGLNRRVEVDSLACPKFVSVVESGEYKAIAKKVVAESLLPLKSTKIDTVILGCTHYPLLKPIIENGVAVINSGEETASEVSALLDY 220
5 -24.000IDP00007 gene: racE-1; glutamate racemase BA_0847 [Bacillus anthracis str. Ames]  ali follow..  15  8..SVIGVVGGLT----------VASEIIRQLPKESI-CYIGDNERCP-------PRSVEEVQSFVFEMVEFLKQFPLKALVVACNTAAAALAALQEALSIPVIGVIHPGARAIKVTKKGKIGVIGTVGTIQSNMYEKA------LHELDTYLKVHSHACPTLATVVENRLEDAYVTQQVKQALLPLTKEDIDTLILGCTHYPLLESYIKKDVTIISSAEETAIELSTILQH 225
6 -24.000IDP05326 gene: murI; glutamate racemase [Clostridium difficile 630] CD3562 [Peptoclostridium difficile 630]  ali follow..  14  4..KPIGVLGGLT----------VLKEIMKILPNEDI-IYFGDTARIP-------SRSKETIIKYTFQAINFLKTKGVKAIVIACNTATARLKEAQEKYDIPIIGVIEAGARAVSSTKNKIVGIIGTEGTISSKAYNLE------ISKIDESIEIVNKACPLFVPIVEEGWANEVAKLTAKIYLQELKEKNIDSLVLGCTHYPILKRTIGEHIKLVNPAKETAKDLKKILEV 221
7 -23.900IDP00018 gene: racE-2; glutamate racemase BA_4717 [Bacillus anthracis str. Ames]  ali follow..  14  5..RAIGVVGGLT----------VAKELIRQLPKERI-IYLGDTARCP-------PRSREEVRQFTWEMTEHLLDLNIKMLVIACNTATAVLEEMQKQLPIPVVGVIHPGSRALKVTNTYHVGIIGTIGTVKSGAYEEA------LKSINNRVMVESLACPPFVELVESGNFEEMAYEVVRETLQPLKNTDIDTLILGCTHYPILGPVIKQKVQLISSGDETAREVSTILYH 222
8 -23.500IDP00328 gene: murI; glutamate racemase Cj1652c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  3....IGVVGGLS----------VLKSLYEARLFDEI-IYYGDTARVP-------VKDKDTIIKFCLEALDFFEQFQIDMLIIACNTASAYLDALRAKAHFPVYGVIDAGVEATIKDKNKEILVIATKATIKSEEYQKRLLSQGYTNIN---ALATGLFVPMVEEGIFEGDFLQSAMEYYFKNI-----TTPDALILACTHFPLLGRSLSKKTKLIHSGDAIVEFLKE.... 213
9 -23.400IDP06272 glutamate racemase [Streptococcus pneumoniae TIGR4] NP_346313 [Streptococcus pneumoniae TIGR4]  ali follow..  19  4..RPIGFVGGLT----------VVRELMRQLPHEEI-VYIGDSARAP-------PRPAEQIREYTWQLVNFLLTKDVKMIVIACNTATAVWEEIKAQLDIPVLGVILPGASAIKSSQGGKIGVIGTPMTVQSDIYRQK------IHDLDPDLQVESLACPKFAPLVESGALSTSVTKKVVYETLRPLVGKVDSLILGCTHYPLLRPIIQNKVQLIDSGAECVRDISVLLNY 220
10 -23.100IDP00335 gene: murI; glutamate racemase FTT1197c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  14  1MLDNIGVIGGLT----------IVKNLMSILPNEDI-IYFGDIARIP-------TKSRATIQKFAAQTAKFLIDQEVKAIIIACNTISAIKDIVQEIAAIPVIDVITAGVSLVDNLN--TVGVIATPATINSNAYALQ------IHKKNPNIEVYSNPCGLFVSMIEEGFVSHIVELVAKEYLSYFHDKNIQALILGCTHYPIIKEAKILDVKLIDPSLQASKMLYSLLFE 218
11 -23.000IDP01362 glutamate racemase VC0158 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  7..PRVLIVGGLS----------VYREIEARLPQLNYIYL-NAAYPYGELTQETLIARVDTLVTRM------VEQERIDLVVIACNTASTILPVLRAKLTIPVVGVVPAIKPASLIAS-KAIGLIATPATVKRQYTQEL------IRDFSANKNVELLGSTRLVNMAEEKLRGKPLDLEELASILQPLKNTIDVAVLGCTHFPLIKEEIQQQVQLIDSGLAIARRVQELL.. 220
12 -22.700IDP00597 gene: murI; glutamate racemase YPO3909 [Yersinia pestis CO92]  ali follow..  15  25.RPTALIVGGLS----------VYQEIRQLLPDLHY-IYAFDNVAFP-------EKSGEFIVERVLEIVTAVQRHPLAIVVIACNTASTVLPALRERFAFPVVGVVPAIKPAVRLTRNGVVGLLATRATVHASYT-LDLIARFATDCKIELLGSSELVEVAETKLHGGVVPLEVLKKILHPWLSM--REPPDTIVLGCTHFPLLTEELAQGTRMVDSGAAIARRTAWLISS 245
13 -20.700IDP00309 gene: murI; glutamate racemase CBU_0298 [Coxiella burnetii RSA 493]  ali follow..  13  5..RPIGVMGGLT----------VLRELVNHLPNESY-IYLGDTARLP-------TKSPETVSRYATQMASILIAQNIKLLVVACNTASTALPQLQQQFHIPIIGVVEPGARAVVATKNNKVALLATETTIQSGIYQNT------LRALSPQIEITTQTCGLFVALAEEGCTNEIALLVAKKYLEPIINHQCDSVILGCTHFPVLMEPLAAQINIINSAKATATEVQSILQK 225

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24