current user: public

If you have questions about the server, please let us know.

Query: IDP04210 ZZZ_0017 [Escherichia coli O157:H7 str. EDL933], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240
# Score Template Links and tools%idFirst MINNVSSLFPTVNRNITAVYKKSSFSVSPQKITLNPVKISSPFSPSSSSISATTLFRAPNAHSASFHRQSTAESSLHQQLPNVRQRLIQHLAEHGIKPARSMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLVQHLAEHGIQPARNMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPPLPVQNEQSRPLPDVAQRLMQHLAEHGINTSKRSLast
1 -71.100IDP04210 ZZZ_0017 [Escherichia coli O157:H7 str. EDL933]  ali  100  1MINNVSSLFPTVNRNITAVYKKSSFSVSPQKITLNPVKISSPFSPSSSSISATTLFRAPNAHSASFHRQSTAESSLHQQLPNVRQRLIQHLAEHGIKPARSMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLVQHLAEHGIQPARNMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPPLPVQNEQSRPLPDVAQRLMQHLAEHGINTSKRS 243
2 -32.100IDP91616 gene: ECs2715; EspF-like protein [Escherichia coli O157:H7 str. Sakai] BAB36138 [Escherichia coli O157:H7 str. Sakai]  ali follow..  96  1MINNVSSLFPTVNRNITAVYKKSSFSVSPQKITLNPVKISSPFSPSSSSISATTLFRAPNAHSASFHRQSTAESSLHQQLPNVRQRLIQHLAEHGIKPARSMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLVQHLAEHGIQPARNMAEHIPPAPNWPAPPLPVQNEQSRPLPDVAQRLVQHLAEHGIQPARSMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLMQHLAEHGIQPARN. 242
3 -22.200IDP91949 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007099 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  781.........IPVTFMANAYLDNQSTYIVEVPILEKENQTDKPSILPQFKRNKAQENSKLDEKVEEPKTSEKVEKEKLSETGNSTSNSTLEEVPTVDPVQEKVAKFAESYGMKLENVLFNMDGTIELYLPSGEVIKKNMADFTGEAPQGNGENKPSNGKVSTGTVENQPTENKPADSLPEAPNE--KPVKPENSTDNGMLNPEGNVGSDPMLDPALEEAPAVDPVQEKLEKFTASYGLGLDS.. 1011
4 -19.100IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali follow..  1631.....AAAIPSILLPTDGEDGEKEKTKEKKTEKKKEKHTEKKHKKKSEALPESETTAVVTVTPGEEDETSPLVPVPSSIASSEAPEPPASTRVTPAPEPKAKPGLSMGAALLAVRARSRLQRKHLAQQLSSSSSSEVSASSASSLSPSSSSSSDFAETRAKADALRARLQAAQARLAAARETEVSSSETESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMVSGVKAAYRRLEEENT 1868
5 -15.500IDP06012 membrane-attack complex / perforin domain-containing protein [Toxoplasma gondii ME49] EEB00555 [Toxoplasma gondii ME49]  ali follow..  1MLLSAIGGIGPTESRLQHIPFSTTRYLPIRSHVLQSTVERIESPEALNEVPTKVERNEFTEKGDKTEQVLTAQADHKSLLEGRSVRLESTSTAPDDDFDFLFEDDTPKKPKSRVNKGTSSDETSPGDRSSGEGSSDSDSLLSVVHRTKGNATQANKNQTRITHPKSKAQHQKKVTKKQGIPGSDSLGTSSADFDFDIDSSSNTQADDSQRQSLGDSSALDLFGSDTGDTGDIFGFSNSSSDGG 243
6 -14.900IDP05070 putative surface protein [Clostridium difficile 630] CD3246 [Peptoclostridium difficile 630]  ali follow..  510...................................................................PKAIQYYKAVLDLGQKDHSSSLPSSKQNLLSYTIEKKNGQEVNFNIGLPTDDDDVVNPPVPPIDDDVVNPPVPPTDDTNGHKPKPSPPNPPVPPPPVPPTEDAVLNPPVPPMEDAVLNPPVPPTDDTVLNPPVPPVSDTVEKTPELSRDDTIVKSPKT.................. 680
7 -14.400IDP91577 gene: ECs4550; EspF protein [Escherichia coli O157:H7 str. Sakai] BAB37973 [Escherichia coli O157:H7 str. Sakai]  ali follow..  30  1MLNGISNAASTLGRQLVGIASRVS-SVAPQAVRLTPVKVHSPFSPGSSNVNARTIFNVSSSRPAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTGP-------GLPPLAQALKDHLAAYEQSKK... 247
8 -14.200IDP91679 gene: vIRF-3; vIRF-3 [Human herpesvirus 8] HHV8GK18_gp64 [Human herpesvirus 8]  ali follow..  136ILYQHSVRLEKHRRRPRPFVGENSDSSEEDHPAFCDVPVTQTGAESEDSGDEGPSTRHSASGVQPVDDANADSPGSGDEGPSTRHSDSQPPPADETTVHTDNVEDDLTLLDKESACALMYHVGQEMDMLMRAMCDEDLFDLLGIPEDVIATSQPGGDTDASGVVTEGSIAASAVGAGVEDVYLAGALEAQNVAGEYVLEISDEEVDDGAGLPPASRRRPVVGEFLWDDGPRRHERPTTRRIRH 378
9 -13.500IDP05117 putative collagen-binding protein [Clostridium difficile 630] CD2831 [Peptoclostridium difficile 630]  ali follow..  11  9LLISLIMILSMV-----------------STIYPTVSYASELGENSQIQSGSTNSSTGEEKESDNKKPEQTPEKDKATDNKKPEQTPEEEKPTDNKKPEQTPEEDKSTDNKKPEQTP---EGEKPIDNKKPEQIPEEDKSTDNKKSEQALEDEKPLDNKNTEKTPEEDNLLEDEN.................................................................... 164
10 -12.100IDP06427 gene: B21R; B21R [Monkeypox virus Zaire-96-I-16] NP_536609 [Monkeypox virus Zaire-96-I-16]  ali follow..  575..KEYNERYGRSVSRTQSSSSESDFEDIDTVVREYRQKYGNAMAKGRSSSPKPDPLYSTVKKTTKSLSTGVDIVTKQSDYSLLPDVNTGSSIVSPLTRKGATRRRPRRPTNDGLQSPNPPLRNPLPQHDDYSPPQVHRPPTLPPKPVQNPTQLPPRPVGQLPPPIDQPDKGFSKFVSPRRCRRASSGVICGMIQSKPNDDTYSLLQRPKIEPEYAEVGNGIPKNNVPVIGNKHSKKYTSTMSK 815
11 -11.900IDP02382 hypothetical protein lmo0320 [Listeria monocytogenes EGD-e] lmo0320 [Listeria monocytogenes EGD-e]  ali follow..  11  167.INAVQEQINTVTSSEKESFQEQ-----------NNAQQQLDARIAQEQAAIQAVNQLFLEDSPVNSIKAETTQDLIDQAQTLVDVLPASELKDTLQANIVKAQTELDERSKPVTPPKNDPEPDNPEEPVTPVDPA--TPIPDEPSTPTDPATPEKPEITTPENPESTVVEADSSENEPEKS----ADSKIVNNPIQITSQATKTATKQAKSSATKTTLPLPKAGDT................ 376
12 -10.400IDP91924 pneumococcal histidine triad protein B [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007441 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  430................................................................................................PNERPHSDNGFGNASDHVQRNKNGQADTNQTEKPNEEKPQTEKPEEETPREEKPQSEKPESPKPTEEPEEESPEESEEPQVETEKVEEKLREAEDLLGKIQDPIIKSNAKETLTGLKNNLLFGTQDNNTIMAEAEKLLALLKESK.. 574
13 -10.400IDP06042 hypothetical protein jhp0369 [Helicobacter pylori J99] NP_223088 [Helicobacter pylori J99]  ali follow..  1M--GINMCSKKIRNLILCFGFILSLCAEENITKENMTETNTTEENTPKDAPILLEEKRAQTLELKEENEVAKKIDEKSLLEEIHKKKRQLYMLKGELHEKNESILFQQMAKNKS................................................................................................................................. 112
14 -10.200IDP91542 3`,5`-cyclic phosphodiesterase, putative [Toxoplasma gondii ME49] TGME49_080410 [Toxoplasma gondii ME49]  ali follow..  2..........AAESSPSGPIESAGLAARDESPTRSSTSSLDP--------DQQTCEHASSLPSLRESPRASASSSGVASKAGEGPRLLTFLPQRLHEATPPQDGALPAASGHGHTDAETHAQGANPGEARPQAGPDSDSKTSSSPLSFLTSLAVASKQKAHAEGVSSHASSISGKRRAQGV-EKLSVGSSKTALVSLDEESDVSGADSAASVLSSQWASGEDRTIGAKPVPDRARWTTTAHDA 227
15 -9.540IDP06368 gene: ORF64; ORF64 [Human herpesvirus 8] YP_001129421 [Human herpesvirus 8]  ali follow..  10  266.....DETRPRRPRVVIPPYDPTDRPRPPHQDRPPEQAAGYGGNKGRGGNKGRGGKTGRGGNEGRGGHQPPDEHQPPHITAEHMDQSDGQGADGDMDSTPANGETSVTETPGPEPNPPARPDREPPPTPPATPGATALLSDLTATRGQKRKFSSLKESYPIDSPPSDDDVSQPSQQTAPDTEDIWIDDPLTPLYPLTDTPSFDITADVTPDNTHPEKAADGDFTNKTTSTDADRYASASQESL 504
16 -9.300IDP00768 superantigen-like protein SACOL0470 [Staphylococcus aureus subsp. aureus COL]  ali follow..  17.........................TTGAITVTTQSVKAEKIQSTKVDKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAPNTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQAQTDMTPK................................................................... 167

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.