current user: public

If you have questions about the server, please let us know.

Query: IDP04295 gene: nuoA; NADH dehydrogenase I, A subunit [Francisella tularensis subsp. tularensis SCHU S4] FTT0031 [Francisella tularensis subsp. tularensis SCHU S4], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MSTSVYEQFAPILIFLIIAFGLGAAFAIIGKVLSVIVGANNPNKTKGETFECGFPTFGDAREKLDVRFYLIAVLFLVFDLELAFIIPWGINLRASAGMPAISDHAFFAMIIFLVVLFLGLIYAWKKGALEWELast
1 -80.400IDP04295 gene: nuoA; NADH dehydrogenase I, A subunit [Francisella tularensis subsp. tularensis SCHU S4] FTT0031 [Francisella tularensis subsp. tularensis SCHU S4]  ali  100  1MSTSVYEQFAPILIFLIIAFGLGAAFAIIGKVLSVIVGANNPNKTKGETFECGFPTFGDAREKLDVRFYLIAVLFLVFDLELAFIIPWGINLRASAGMPAISDHAFFAMIIFLVVLFLGLIYAWKKGALEWE 132
2 -8.050IDP06152 gene: fixP; cytochrome oxidase (CBB3-type) [Helicobacter pylori J99] NP_222856 [Helicobacter pylori J99]  ali follow..  2...DFLNDHINVFGLIAALVILVLTIYESSSLIKEMRDSKSQGELMENGHL-GIGEFANNVPVGWIASFMCVIVWAF....................................................... 76
3 -6.670IDP06445 gene: H3L; H3L [Monkeypox virus Zaire-96-I-16] NP_536520 [Monkeypox virus Zaire-96-I-16]  ali follow..  25  279......................................................................LISFFGLFDINVIGLI----------------------VILFIMFMLIFNV----KSKLLW. 313
4 -6.120IDP04254 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1823 [Clostridium perfringens ATCC 13124]  ali follow..  190.....................................MLMLNNILNMFGNMFSFMFIRRPFIGIGTILLIALIIFAI....................................................... 229
5 -5.420IDP95379 set238a-016 [Vibrio cholerae]  ali follow..  17  794LNTTKVLGTKDALKTFAKSIALVATVGMIASGLEAWESWGKFNDSSKTDLE---------RFGYLLKAGTMVTQLIVFAGQLIARKLSLMGIVSIGAINAGWMVASFAVIGIVYLIGVILTNVFKRSDLEW. 916
6 -5.410IDP95307 hypothetical protein VCA0020 [Vibrio cholerae O1 biovar El Tor str. N16961] NP_232421 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  794LNTTKVLGTKDALKTFAKSIALVATVGMIASALETWESWGKFNDSSKTDLE---------RFGYLLKAGATGAQGIIFYIQFFTLLGSGIGGPSIAAISAGWMLAGFAVIGIVYLIGVILTNVFKRSELEW. 916
7 -5.310IDP95369 set238a-013 [Vibrio cholerae]  ali follow..  18  794LNTTKVLGTKDALKTFAKSIALVATVGMIASALETWESWGKFNDSSKTDLE---------RFGYLLKAGATGAQGIIFYIQFFTLLGSGIGGPSIAAISAGWMLAGFAVIGIVYLIGVILTNVFKRSELEW. 916
8 -4.970IDP91944 ABC-type antimicrobial peptide transport system, permease component [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100000842 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  16  287............FMTTIISSIAGISLFVGGTGVMNIMLVSVTERTR----EIGLKALGATRANILIQFLIESMILTLLGGLIGLTIASGLTIEGIEVGVSIPVALFSLAVSASVGMIFGVLPANKASKLD.. 411
9 -4.870IDP91750 SPG2_STRSG [Streptococcus sp. `group G`]  ali follow..  16  6................................................................KVKYFLRKSAFGLASVSAAFLVGSTVFAVDSPIEDT................................ 41
10 -4.820IDP04565 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1805 [Clostridium perfringens ATCC 13124]  ali follow..  12  1............MIKKIVVAVGLAFSLSFLVGCG-----------NKSLVEQGKAAIKQGNYEEATAIFKAAS........................................................... 50

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.