current user: public

If you have questions about the server, please let us know.

Query: IDP04391 gene: cotJB; spore coat protein CotJB [Clostridium perfringens ATCC 13124] CPF_1067 [Clostridium perfringens ATCC 13124], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst MKALELLDDIQKLQFYAVELNLYLDNFPENRKATEDYKEISSKLSELIERFECEYGPIRNFGQAYVENPVAWIEQPWPWEIRYLast
1 -57.700IDP04391 gene: cotJB; spore coat protein CotJB [Clostridium perfringens ATCC 13124] CPF_1067 [Clostridium perfringens ATCC 13124]  ali  100  1MKALELLDDIQKLQFYAVELNLYLDNFPENRKATEDYKEISSKLSELIERFECEYGPIRNFGQAYVENPVAWIEQPWPWEIRY 83
2 -7.470IDP95409 set236a-011 [Undefined organism]  ali follow..  12  94...RELIAAIVNMARERSTQALVVGTASTSVDNILFYQKCGFRMDSVRKDFFNYKTPVYEHGIQLRD................ 158
3 -7.200IDP92718 gene: aacC1; aminoglycoside-(3)-N-acetyltransferase [Serratia marcescens] AAB20441 [Serratia marcescens]  ali follow..  124...TALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDIDPS............................. 174
4 -7.180IDP92642 gene: rimI; ribosomal-protein-S18-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4373 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  82...RALLEHLIDELEKRGVATLWLEVRASNAAAIALYESLGFNEATIRRNY................................ 129
5 -7.000IDP95410 set236a-012 [Undefined organism]  ali follow..  15  99...TELINELKAIAAKTGAWVIFVQADREDEPAIQLYEKLGVREEPLHFDINLEEG........................... 151
6 -6.840IDP95033 ; aminoglycoside acetyltransferase [Pseudomonas aeruginosa] CAD53575 [Pseudomonas aeruginosa]  ali follow..  103...TALINELQRIAHDIGAYVIFVQADYGDDPAVALYTKLGIREDVMHFDIEPQ............................. 153
7 -6.430IDP91869 gene: aac(6`)-Ih; aac(6`)-Ih [Acinetobacter baumannii] AAC41391 [Acinetobacter baumannii]  ali follow..  11  94...TGLVQQVEIWAKQFACTEFASDAALDNQISHAMHQALGFHETERVVYFKKNIG........................... 146
8 -6.380IDP05730 putative acetyltransferase [Clostridium difficile 630] CD0675 [Peptoclostridium difficile 630]  ali follow..  22  99...SSLLKQIIDLSKEYGYEKIELDVFKSNSRAIHVYKSLGFVEVNTISSGFTWND........................... 151
9 -6.370IDP95031 ; aminoglycoside 3`-N-acetyltransferase [Pseudomonas aeruginosa] AAA88422 [Pseudomonas aeruginosa]  ali follow..  123...TALISHLKRVAVELGAYVIYVQADYGDDPAVALYTKLGVREDVMHFDIDPR............................. 173
10 -6.330IDP91766 gene: yhhY; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3441 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  15  97...SALMREMIEMCDNWLRVDIELTVFVDNAPAIKVYKKYGFEIEGTGKKYALRNG........................... 150

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35