current user: public

If you have questions about the server, please let us know.

Query: IDP04461 gene: pyrC; dihydroorotase [Yersinia pestis CO92] YPO1587 [Yersinia pestis CO92], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .
# Score Template Links and tools%idFirst MTAQPQTLKIRRPDDWHIHLRDDEMLSTVLPYTSEVFARAIVMPNLAQPITTVASAIAYRERILAAVPAGHKFTPLMTCYLTNSLDAKELTTGFEQGVFTAAKLYPANATTNSTHGVSDIPAIYPLFEQMQKIGMPLLIHGEVTDAAVDIFDREARFIDQILEPIRQKFPELKIVFEHITTKDAADYVLAGNRFLGATVTPQHLMFNRNHMLVGGIRPHLFCLPILKRSTHQQALRAAVASGSDRFFLGTDSAPHAKHRKESSCGCAGVFNAPAALPAYASVFEELNALQHLEAFCALNGPRFYGLPVNDDVVELVRTPFLQPEEIPLGNESVIPFLAGQTLNWSVKRLast
1 -128.000IDP04461 gene: pyrC; dihydroorotase [Yersinia pestis CO92] YPO1587 [Yersinia pestis CO92]  ali  100  1MTAQPQTLKIRRPDDWHIHLRDDEMLSTVLPYTSEVFARAIVMPNLAQPITTVASAIAYRERILAAVPAGHKFTPLMTCYLTNSLDAKELTTGFEQGVFTAAKLYPANATTNSTHGVSDIPAIYPLFEQMQKIGMPLLIHGEVTDAAVDIFDREARFIDQILEPIRQKFPELKIVFEHITTKDAADYVLAGNRFLGATVTPQHLMFNRNHMLVGGIRPHLFCLPILKRSTHQQALRAAVASGSDRFFLGTDSAPHAKHRKESSCGCAGVFNAPAALPAYASVFEELNALQHLEAFCALNGPRFYGLPVNDDVVELVRTPFLQPEEIPLGNESVIPFLAGQTLNWSVKR 348
2 -125.000IDP00873 gene: pyrC; dihydroorotase STM1163 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  72  1MTAPSQVLKIRRPDDWHVHLRDGDMLKTVVPYTSEIYGRAIVMPNLASPITTVDAAIAYRQRILDAVPAGHDFTPLMTCYLTDSLDADELERGFHEGVFTAAKLYPANATTNSSHGVTSVDAIMPVLERMEKLGIPLLVHGEVTHADVDIFDREARFIDTVMEPLRQRLTALKVVFEHITTKDAAQYVRDGNDYLAATITPQHLMFNRNDMLVGGIRPHLYCLPILKRNIHQQALRELVASGFTRAFLGTDSAPHSRHRKETSCGCAGCFNAPSALGSYAAVFEEMNALAHFEAFCSLNGPQFYGLPMNTGWVELVRDEQQIPGNIALADDSLVPFLAGETVRWSVKK 348
3 -121.000IDP90537 RecName: Full=Dihydroorotase; Short=DHOase Q9KL24 [Vibrio cholerae]  ali follow..  54  2.....TTLTITRPDDWHVHLRDGDVLADTVRDISRYNGRALIMPNTVPPVTTTEMALAYRERIMAAQPQ-AHFEPLMALYLTDNTSPEEIRKAKASGKVVAAKLYPAGATTNSDSGVTSAKNIYPVLQAMQEVGMLLLVHGEVTTHEVDIFDREKTFLDTVLAPIVNDFPQLKIVLEHITTADAVTFVQQAGDNVAATITAHHLLFNRNHMLVGGIRPHFYCLPILKRATHQHALVAAATSGSKKFFLGTDSAPHAKGRKEAACGCAGSYTAHAALELYAEVFEKEGKLENLEAFASFNGPDFYGLPRNQETVTLTKQAWPVAESMPFGSDIVVPIRAGENIEWTVK. 342
4 -109.000IDP90750 gene: pyrC; dihydroorotase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0259 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  35  1.......MKLKNPLDMHLHLRDNQMLELIAPLSARDFCAAVIMPNLIPPLCNLEDLKAYKMRILKACK---DENFTPLMTLFFKNYDEKFLYSAKDE-IFGIKLYPAGITTNSNGGVSDIEYLKPTLEAMSDLNIPLLVHGETNDF---VMDRESNFAKIYEK-LAKHFPRLKIVMEHITTKTLCELLKDYE-NLYATITLHHLIITLDDVIGGKMNPHLFCKPIAKRYEDKEALCELAFSGYEKVMFGSDSAPHPKDTKECCGCAAGVFSAPVILPVLAELFKQNSSEENLQKFLSDNTCKIYDLKKEDKILTLEEKEWQVPNVYEDKYNQVVPYMAGEILKFQLKH 335
5 -76.900IDP00795 gene: pyrC; dihydroorotase SACOL1213 [Staphylococcus aureus subsp. aureus COL]  ali follow..  17  42IIDAKGHFVSPGFVDVHVHLREPGIETGTKAAARGGFTTVCPMPNTRPVPDSVEHFEALQKLIDDNAQVRVLPY----ASITTRQLGKELVDFPALVKEGAF------AFTDDGVGVQTASMMYEGMIEAAKVNKAIVAHCEDNSLGIPGIPNICESVQIARDVLLAEAAGCHYHVCHVSTKESVRVIRDAKRAVTAEVTPHHLLLTEDDI--PGNNAIYKMNPPLRSTEDREALLEGLLDGTID-CIATDHAPHARDEKAMEKAPFGIVGSETAFPLLYTHFNGDWTLQQLVDYLTIKPCETFNLEYADLTIIDLDSEQEIKGEDFLSKADNTPF-IGYKVYGNPIL 411
6 -76.400IDP02818 gene: pyrC; dihydroorotase [Bacillus anthracis str. `Ames Ancestor`] GBAA4027 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  17  43VIDVNGKLIAPGLVDVHVHLREPGIETGTLAAAKGGFTTICAMPNTRPVPDCREHMEDLQNRIKEKAHVNVLPY----GAITVRQAGSEMTDFETLKELGAF------AFTDDGVGVQDASMMLAAMKRAAKLNMAVVAHCEENTLGLNGIPSVCESVHIARDILLAEAADCHYHVCHVSTKGSVRVIRDAKRKVTAEVTPHHLVLCEDDI--PSADPNFKMNPPLRGKEDHEALIEGLLDGTID-MIATDHAPHTAEEKAIERAPFGITGFETAFPLLYTNLKGIITLEQLIQFLTEKPADTFGLETADITIIDLEQEEEIDPTTFLSKGKNTPF-AGWKCQGWPVM 412
7 -22.100IDP01088 gene: iadA; isoaspartyl dipeptidase STM4512 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  52VINLSGRMLCPGFIDQHVHLIGGG-EVSLSRLTEAGITTVVGLLGTDSVSRHPASLLAKTRALNEEGITAWMLT-GAYHVPSPTITGSVEKDVALIDRVIGVKC----AVSDHRSAAPSGNQLASMAAESRVGGL---LGGKPGVSVFHMGSSKKGLQPLYDILENSDVPIGKLLPTHVNRSESLQALAFALKGGVIDITT--------------------IPDPVAPAEGIARAVKAGVPLSRVTLSSDGNGSQPLFDAAGNLTGIGVAGFESLLETLQTLVNHGFSLANALRPLTTSVAAFLSLDGNDADLLVFSADLRIEQVYARGK-----VNEGKAC...... 382
8 -15.000IDP04464 gene: hutI; imidazolonepropionase [Yersinia pestis CO92] YPO1972 [Yersinia pestis CO92]  ali follow..  56QVVYEGGLITPGLIDCHTHQRLNGVSYAEIAANGGGIISTVRATRQASEQQLLEQALFRLKPLLAEGVTTIEIKSGYGLNLESEIKMLRVARRLGELLPIDVKTTCLAAHALPPEFIGQPDDYIDVVCNSIIPQVAVENLADAVDAFCEHLAFSPAQVERVFLAAQKAGLPVKLHAEQLSALRGATLAAK----FHAISADHLEYATESDVAMANAGTVAVLLP-YLLRETQCPPIDLFRQYKVPMALASDANPGTSP------------VLSLRLMLNMACTLFRMTPEEALAGVTCHAAQALGVQQANWVHWPLSHPAELLPATVVFRGEVRP............. 406
9 -13.700IDP00351 gene: adeC; hypothetical protein lmo1742 lmo1742 [Listeria monocytogenes EGD-e]  ali follow..  10  62IIDAAGAFIAPGFIDAHVHVESAMVAEFARVLLPNGVTTIVTDPHEIANVAGEKGIEFMLEDAKGAPLDMFVMLPSSVPATEGEHNGETLHAEKLHPLYRHEKVIGLAEVMDFPSVAKGSDDILRKIIDAKKEGGRIDGHGAGLT-------------------------------------------ADLNNYLAVGIRTDHESTTAKEATDRLRAGMFVMLREGTVGRDLLQTIPAVSEKNSHCFCTDDKLINDLITE-------GSIN------NIKLAIKNGIDPITAIQMATINAANCHNLPYADIVFLTDIETVEISKVLKNGE.................. 350
10 -12.900IDP00957 gene: ycfH; predicted metallodependent hydrolase STM1202 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  10  3............LVDSHCHLDHKDVDDVLAKAAARDVKFCLAVATTLPGYRHMRKLVGKRDNVVFSCGVH---------NQDEAYDVEELRLLAAEDDVVAMGETGLDYFYTPETKIRQQASFIHHIQIGRELHKPVIVHTRD------------------------------------ARADTLAILREEKVTDCGGVL--HCFTEDRETAGKLLDLGFYIS--IVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPH------GKENQPAMVRDVAEYMAVGVAVEELAQITTDNFARLFHIDASRLSSI.................................. 264
11 -12.400IDP00130 gene: yjjV; putative deoxyribonuclease YjjV NT01ST5659 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  5............FIDTHCHFDTGDERASIQRACEAGVEKIIVPATEAAHFPRVLALAARFPSLYAA----LGLHPIVIERHADDDSDKLQQALAQQQNVVAVGEIGLDLYRDDPQFARQERFLDAQLQLAKRYDLPVILHSRR------------------------------------THDKLAMHLKRQDLPRTGVV---HGFAGSLQQAERFVRLGYKIG--TITYPRASKTRDVMARLPLDALLLETDAPDMP-----LKGFQGQPNRPEQAARVFDALCEPEPAEVIADTLYRNTITLFRL.......................................... 257
12 -11.300IDP01334 gene: nagA; N-acetylglucosamine-6-phosphate deacetylase VC0994 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  43VVDLNGANLSPGFIDLQLN-TAETIDTMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKYPNQSLGLHL---PYLNVMKKGIHSVDFIRPSDDTMIDTICANSDVIAKVTLAPENNKPEHIEKLVKAGIVVSIHTN-----------------ATYSEARKSFESGITFATHL---NAMTPMVGREPGVVGAI------YDTPEVYAGIIADGFHVDYANKIKGEKLVLVTGAEMDYFIFVGKKVYYRDGKCVDENGTLGGSALTMIEAVQNTVEHV--GIALDEALRMATLYPAKAIGVDEKIANLTVFDRDFNVKATVVNGQ.................. 374
13 -11.100IDP04112 gene: nagA; putative N-acetylglucosamine-6-phosphate deacetylase [Yersinia pestis CO92] YPO2626 [Yersinia pestis CO92]  ali follow..  10  43ICDLGGAILAPGFIDVQLN-SAETLDIMQRANEKSGCTSFLPTLITCSDEFMKHGVDVMRSYLQKNQHQALGLHL---PYISPLKKGTHNPAFIRKPSAEMIDYLCANADVITKLTLAPEMVDPKYIQQLTEAGILVSAHSN-----------------ATYQQARQGFTAGIRFATHL---NAMPYISGREPGLIGAI------FDTPEVYTGVIADGLHVDWANRLKGEKLVLVTGAKIEQFIFAGKTIYYRDGLCVDENGTLSGSALTMIEAVQNSVEHV--GIALDEALRMATLYAARAIGVDKQVANLTAFTRDYKITKTIVNGN.................. 377
14 -10.800IDP00657 gene: nagA; N-acetylglucosamine-6-phosphate deacetylase SACOL0761 [Staphylococcus aureus subsp. aureus COL]  ali follow..  12  52VIDAKGHHVLPGFIDIHIH-SYDGLKYLSENLLSEGTTSYLATTMTQSTDKIDNALTNIAKYEAE----------------QDVHNAAEIVGIHLEGPFISEN---VGAQHPQYVVRPFIDKIKHFQETANGLIKIMTFAPEVEG---------------AKEALETYKDDIIFSIGH--TVATYEEAVEAVERGAKHVT--HLYWLNDALHTEMIVDGTHSHPASVAIAYR-------MKGNERFYLITDAMR-TVQSQQARLANGALAGSILKMNHGLRNLISGDTLDHLWRVTSLNQAIALGIDDRDADLVILDDDMNVKSTIKQGK.................. 388
15 -10.500IDP04718 putative acetylglucosamine-6-phosphate deacetylase [Yersinia pestis CO92] YPO0838 [Yersinia pestis CO92]  ali follow..  11  42IVHLTGKTLIPGLIDIHIH-SAEALRTIARALPQTGVVAWVGTTVSAPIQDIFAALAQVRDFIADPDN-------------ARDTRTATLLGSFLEGPYFTAP---RGSHPEKYLTTPTPQELEQLRHSAGNTLLRAAIAPESPE--------------ALAAIRWLVNHGIKTSVAH--TAANFEQVTAAYQQGADCGV--HLY--------NGMSGLHHREPCCGAVLYHDMLAELIADGI-RIALITDCMR-TVRQGEARTDDGSLAGSTCSLDQALRNMIQQVPEWEAVQMASAVPAAYLGLASTQASMVVMESDFTVAATLIKGE.................. 381
16 -10.100IDP02603 gene: nagA; N-acetylglucosamine-6-phosphate deacetylase [Bacillus anthracis str. `Ames Ancestor`] GBAA4274 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  10  46VLDAAGKIVIPGMIDVHIH-NSDGLVTLGKEMLKEGVTTYFPTTMTQAPEAIEAALHAAKEAKEKGAHF-----------EYIHLEGPYVSKKRA------------GAQPLEHIVPANIEQFKQWQEASGNLIKLVTYAPEEEG--------------ALEFEQYLAETGVVGTMGH-TDAIDAQLKNRNITHATQMRGLHHHVLLNPDVMVEVITDGIHIHPDMVKLAYK-------LKGPKKVSVITDAMR-HVKDGSARLEDGTLAGSILKMDQAFRNVIEGCSIEDAVLMTSVNQAEEFGLNNKDADFVVMNEDLHVYDTVRLGI.................. 374
17 -9.750IDP00467 N-formimino-L-glutamate deiminase YPO1974 [Yersinia pestis CO92]  ali follow..  10  40GCQVLSGPVLPGMPNLHSHMS--IARQLYIEMLKGGYTQVAEFHHSPDGSPYNDIGEMTAQLSQAAQDAGIGMTLLPVLYSYAGFGAQPAQQGQSR------------FIQDTESYLRQQQVIRRQLANQPLQNQGLCFHS------------RAVELSQMQQILHVSDKQLPVHI-HIAEQQKVAWLYGHLPVDSRWCLVHATHLDTSELMLANSQAVAGLCPTANLGDGIFPGVDYIHHQ-GRWGIGSDSGQRLRDQRRNRLTCERQPAVADLLYSQALAGGRQACGRQISQLAVGYRADWLVLDGDDPYIAGTRSASLLNRWLFAGGKSQI-YVAGKAV...... 429

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35