current user: public

If you have questions about the server, please let us know.

Query: IDP04681 gene: adhB; alcohol dehydrogenase, zinc-containing [Bacillus anthracis str. `Ames Ancestor`] GBAA3131 [Bacillus anthracis str. `Ames Ancestor`], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# Score Template Links and tools%idFirst MKAVTYQGPNQVQVKQVDDAKLEKKDDIIVKITSTAICGSDLHLYQGNMPLPQGYIIGHEPMGIVEEVGPDVTKVKKGDRVVIPFNVACGHCFYCQHEMESQCDNSNPHYDSGGYFGYTEKFGNHPGGQVEYLKVPFGNFTPFVIPESCELEDESLLFLSDVLPTAYWSVINAGVKPGDTVIVLGCGPVGLMTQKFAWMHGAKRVIAVDYLDYRINYAKKINNVEVFEFTKFPDMGEHLKEITHGGADVVIDCVGMDGKKSPLEFLEQKLKLQGGTLGPIQIATKAVRKYGTVQMTGVYGGNYNAFPLGAFWVRNINLKMGQAPVIHFMPELFEKITNKEFDPKEIITHKIPLEEASYGYQIFNNREDDCIKVILKPLast
1 -105.000IDP04681 gene: adhB; alcohol dehydrogenase, zinc-containing [Bacillus anthracis str. `Ames Ancestor`] GBAA3131 [Bacillus anthracis str. `Ames Ancestor`]  ali  100  1MKAVTYQGPNQVQVKQVDDAKLEKKDDIIVKITSTAICGSDLHLYQGNMPLPQGYIIGHEPMGIVEEVGPDVTKVKKGDRVVIPFNVACGHCFYCQHEMESQCDNSNPHYDSGGYFGYTEKFGNHPGGQVEYLKVPFGNFTPFVIPESCELEDESLLFLSDVLPTAYWSVINAGVKPGDTVIVLGCGPVGLMTQKFAWMHGAKRVIAVDYLDYRINYAKKINNVEVFEFTKFPDMGEHLKEITHGGADVVIDCVGMDGKKSPLEFLEQKLKLQGGTLGPIQIATKAVRKYGTVQMTGVYGGNYNAFPLGAFWVRNINLKMGQAPVIHFMPELFEKITNKEFDPKEIITHKIPLEEASYGYQIFNNREDDCIKVILKP 377
2 -96.400IDP00931 gene: ybdR; putative dehydrogenase STM0615 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  42  1MKALTYHGPHHVKVENVPDPGIEQPDDIILRVTATAICGSDLHLYRGKIPVKHGDIFGHEFMGEVVETGHDVKNIRKGDRVVIPFVIACGDCFFCRLQQYSACENTNDGHGAAALFGYSHLYGGVPGGQAEYVRVPKGNVGPFKVPPLLSDDKALFL--SDILPTAWQAAKNAQIQQGFSVAVFGAGPVGLLTIACARLLGAEQIFVVDHHAWRLRFAEERYGAIPINFDDENAEKIIEQTAGHRGVDAVIDAVGFEAKGSLTETVLTNLKLEGSSGKALRQCIAAVRRGGVVSVPGVYAGFIHGFLFGDAFDKGLTFKMGQTHVHAWLGELLPLIEKGLLKPEEIVTHYMPFEEAARGYEIFEKREEECRKVILVP 388
3 -76.100IDP02503 gene: gutB; putative zinc-binding dehydrogenase [Yersinia pestis CO92] YPO2502 [Yersinia pestis CO92]  ali follow..  22  61MSAVVCHGPQDYRLEHVPTPVP-KAKELVIKVKGCGICAGDCKCKNGTPWVKPPVVPGHEFYGHIVALGEGTESYKLGERVIAEQIVPCWDCRYCNSGSYWMCETHNIYGFQKD---------VAEGGMAEYMRFS-ENAIVHKIPESLSHEDAVLI---EPMACAIHTVARGDIQLDDVVVLAGAGPLGLCMVPVARLKTPKKLIVIDTIEERLALAKAFGADVVINPLKEDADKIVKSLTGGYGCDVYIEATGAP--------------------IGVTQGLQMIRKLGRFVEFSVFGQETTVDWSIIGDRKELDIRGAHLA-PYSYEIATDLFERGLVTSKGIVTHSYSLDDWEKAFELADSTN--SIKVILVP 408
4 -57.400IDP90877 oxidoreductase, zinc-binding dehydrogenase family [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1548c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  19  13SKGYAMLSKDAFTPFEFSRHA-IGDNDILIKILYAGICHSDIHTARSEWGATYPCVPGHEIAGEVIAVGKNVSKFKVGDYAGVGCMVSCGECDACKRSQEQFCENGKTIFTYNSC-DVFHGNENTYGGYSNNIVVSEK--FAVCVPKDAPMEKVAPLLCAGI--TTYSPLKFSNIKEGSSVAVAGFGGLGMMAVKYAVKMGA-KVSVFARNENKKADALAMGVSSFYTSCDKNAV--------KERFDLIISTIPTP--------------------YNPAIYLDLLKFGGEMAIVGLPPHEVSISVITFVHKAGKKVYGSLIGGIAETQEMLDFSLKHGIYP---ETELITPQEIDKAYENLTSGKAKFRYVI... 353
5 -44.700IDP04685 alcohol dehydrogenase, zinc-containing [Bacillus anthracis str. `Ames Ancestor`] GBAA3438 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  18  1MKAQIIHDSSVFQLEEVSKPK-LLPGHVLIDVKATSVNPIDTKMRSGAVSAEFPAILHGDVAGIVIEVGEGVSKFKCGDEV----------------------------------YGCAGGFKETGGALAEFMLADAR--LIAHKPNNITMEEAAALPLV--AITAWESLDRANIKSGQNVLIHGTGGVGHVAIQLAKWAGA-NVFTTASQQNKMEIAHRLGADVAINYKEESVQESVQEHTNGNGFEVIFDTVG---------------------GKNLDNSFEAAAVNGTVVTIAARST----HDLSPLHAKGLSLHVTFMALKEILTKITKIVEEGKLRP--LDSKSFTFDEVAQAHEYLESNKA---KIVLKN 333
6 -40.600IDP00076 gene: yhdH; putative oxidoreductase NT01ST4228 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  17  1MQALILEGKTLASVQHLEESQL-PAGDVTVDVHWSSLNYKDALAITGKGKIIRPMIPGIDFAGTVHASE--DPRFHAGQEVLLT---------------------------------GWGVGENHWGGLAERARVKGD--WLVALPAGLSSRNAMIIGTA----TAMLCVDAGIRPQDGEVVVTGAGGVGSTAVALLHKLGY-QVAAVSGRESTHGYLKSLGANRILSRDEFA----ESRPLEKQLWAGAIDTVG---------------------DKVLAKVLAQMNYGGCVAACGLAGGFALPTTVMPFILRNVRLQGVMTPPARRAEAWARLVKDLPESFYAQAATEITLADAPKFADAIINNQV---RTLVK. 322
7 -10.300IDP95362 set237a-002 [Escherichia coli]  ali follow..  43.........................................................................................................................................................................IKHGCINKKSHLLDLACS-TGFSSRECFKKEGA-SAEGIDISESAVMVANEKAKKLKANNLLKYYVADACDL-----EDNTFTHV----------LGGCNFAFIQNRLIALNETHRCLNHMGSMCISNFYYRRKISDKLINDVYNAINFRPNPLWTLEYWHQFFSE---TLVSEENHEMESQSEDELKADIYDYIFNRNEFTKGL... 231
8 -9.990IDP92743 hypothetical protein lpp2747 [Legionella pneumophila str. Paris] YP_125052 [Legionella pneumophila str. Paris]  ali follow..  17  33.........................................................................................................................................................................LAKISIHSNDYLLDAGCGD-GSFTQMLANLVPDGYVLGLDRSKTMIDYANKHCRSINVRFDIGD----IQEPIIYGPFDNILSFWCLH-----------------DLEKSLSNLYHVLKPGGKICAI................................................................................. 139
9 -9.740IDP95435 set236a-037 [Undefined organism]  ali follow..  12  23............................................................................................................................................................................ASLGPVRSVLDLACG-LNPLALPWMPLAPDARYYACDIYADMIAFLNSFFAQAGIRGQ---RVCDLVAGAPDEQVDLAL-------------VLKALPPLDQQAKHAGRDLLRALNARHILVSF................................................................................. 130
10 -9.700IDP95361 set237a-001 [Yersinia pseudotuberculosis PB1/+]  ali follow..  41.........................................................................................................................................................................IEKSRINSNTYLLDLACS-TGFSARNIVHKTGC-SAEGIDISARSIESANQLAVQGNIAECVHFSVGNAESV-----TDNTFTHI----------TAGCCFGFISDKPAALVEVQRVLKQDGFLCISPFFYESEPDNELLSLVEQYIGYRPDIKRDYSYWFNFFN........................................... 190
11 -9.460IDP95457 set236a-001 [Undefined organism]  ali follow..  12  48..............................................................................................................................................................................LPPIHSVIDIACG-LNPLAHPWMPLAPAATYDAYDIYQGMMTFLNDYFALRNIRGT---SACDVIQSCPTQEVDVAL-------------LLKVLPCLEQLEKWAAHHLLHTLNARYLIVSY................................................................................. 153
12 -9.420IDP95458 set236a-002 [Undefined organism]  ali follow..  14  96..............................................................................................................................................................................LPAPHSVLDLACG-LNALTLPWFPHMEAITYYACDIYRPMIDFLNATMEIMHIRGC---EVRDILQSCPTQEADLAL-------------VLKTIPCLEQIDKQAGTRLLRAINARYMIVSF................................................................................. 201
13 -9.240IDP02273 hypothetical protein GBAA3714 [Bacillus anthracis str. `Ames Ancestor`] GBAA3714 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  10  85.........................................................................................................................................................................IEHLQLQGRERILEVGCAN-GKFLSLLQANGHKGQLTGFDQSEAMLSEATKTNNLIEWRLGDAGKLP-----FEANYYDLIV--------------ARHMLYHMKDVEKTIQGFHKVIHPGGSLLATTNSNVTLPRI-CNRMLDTFDLPKTTSSVTPFCLENGKEILQSVFPTVESVIHNALIFHHATPIVNYISS............ 263
14 -9.080IDP92740 hypothetical protein lpp2134 [Legionella pneumophila str. Paris] YP_124446 [Legionella pneumophila str. Paris]  ali follow..  13  23.........................................................................................................................................................................LKTIHSKLSGNILDIGCGD-GHYTSLLAGKVKHGQVLGIDSSEQMIMHANQQWARTGLSFEVHN----IEEFHQPQSFDLALSFWCLH-----------------NIHISFPNIFHLLKREGKLYAV................................................................................. 129

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.