current user: public

If you have questions about the server, please let us know.

Query: IDP04706 30S ribosomal protein S12 [Bacillus anthracis str. Sterne] BAS0105 [Bacillus anthracis str. Sterne], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKKLast
1 -89.600IDP04706 30S ribosomal protein S12 [Bacillus anthracis str. Sterne] BAS0105 [Bacillus anthracis str. Sterne]  ali  100  1MPTINQLVRNGRTDKVWKSKSPALNKGFNSLKKKSTDISAPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDKRMQGRSKYGTKKPKAAKK 140
2 -6.730IDP04649 gene: trmE; tRNA modification GTPase TrmE [Francisella tularensis subsp. tularensis SCHU S4] FTT1283 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  18  208......................................GVILAEGITLILVG----KPNAGKSSLLNALAGKESAIVTSIAGTTRDIVKEHI---------QINGVPMHII----DTAGLRNSDDIIESEGIKRAIKKIQ 292
3 -6.710IDP01354 gene: trmE; tRNA modification GTPase TrmE VC0003 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  220......................................GAIMREGMKVVIAG----RPNAGKSSLLNALSGKESAIVTDIAGTTRDVLREHI---------HIDGMPLHII----DTAGLRDASDAVEKIGIERAWEEIR 304
4 -5.950IDP00337 gene: trpG; anthranilate synthase component II FTT0946 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  38IDQYSHIIIGPGPGHPDELKNIYPIIEYCQQKKLPLLGICLGHQLIAQYYGAKIIKAKQIYHGKLSEIKQLQSSALYKDHPVKFAVIRYHSLI------VNDIKE-PLITLAATDNHEIMAFAHQNAKIFGVQHPEA... 168
5 -5.790IDP00490 putative iron-siderophore receptor YPO1537 [Yersinia pestis CO92]  ali follow..  18  77..................SGSYNTSSMSTATGLNISARETPQSVSVLTK-------------QRMRDQNLNSVESAVNNITGISVR-SDRFGFTSRGMAVNNRDGVRIEVVRGAAGLMAGPGNPSAVINLVRKRPTQDFR 210
6 -5.530IDP92667 hypothetical protein BB0803 [Bordetella bronchiseptica RB50] NP_887352 [Bordetella bronchiseptica RB50]  ali follow..  16  178..............................................VAAVHLPAPQGLCDLVWARAEIALADGAVVRGLVPARYPPSAGQDDGLRLGRATC....................................... 232
7 -5.390IDP91317 Outer membrane receptor protein [Vibrio vulnificus CMCP6] VV2_0843 [Vibrio vulnificus CMCP6]  ali follow..  13  4LRPARTSVAEKKTFKLHALSAVVMGLCASGQAYAQTESTNSNKKEEMPVVVVIGEKTERTIYDTSSSVQVFDQEDLLQLIPNMVDSGQGNSMPTVRGIDGSGIDGRQVEVYLGPQSYIQGGNSSAGAIVMKTNDPTHHFE 192
8 -5.300IDP02127 gene: yajC; preprotein translocase family protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1116c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  20  42.............................................AIFWFLLIRPQQKKNKELRKMLSELSKGDEVVT-MVGKIAKIDETFVDL---------DNVTVKIQRNA.......................... 106
9 -5.090IDP90875 gene: purM; phosphoribosylaminoimidazole synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1529c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  20  85............................................AMCVNDLICNFATPLFFLDYYATAKLEV-EVAKAVVSGIAKGCKMANCALI-GGETAEMPGM----FDLAGFAVGMAEEDEIDRSKFVK....... 172
10 -5.080IDP04136 5-methylthio-3-oxo-1-penten-1,2-diol dioxygenase, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA4258 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  14  76...............................................HDVISLSNSTPNELLINFQKEHHHTDDEVRFIVSGHGIF-GTFFDVELEPGDLISVPNARHYFTLQDDRQVVAIRIFVTTEGW.......... 166

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.