current user: public

If you have questions about the server, please let us know.

Query: IDP05036 hypothetical protein BA_1663 [Bacillus anthracis str. Ames] BA_1663 [Bacillus anthracis str. Ames], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450
# Score Template Links and tools%idFirst MKNVKFFLMSWLCIHVCLLFPLQSKAEEQNVPEQNINEVNVQEENKEVQEQLEQVEMKQDKEEQQEAKNEQETEKKIETDQGVITVNKPELKVGEEVLVTIEPKEKNVQSIKGILRLPKNGDQYEQERMLSFKYEEETKRWIANYKVETFDLQGDWNLQLVQSYKENEKEELVENEVKVPLIHINNEMPTLDKELPKLHKVTIDEMKGNVIERKQGDSIRVRVKATDVESAVKEVHVTLKGKENKEITFLLDYNKRDMDWQKVFEITDALPSGTYELLVEVVDAAGNKLIEASEYVVSVLEQKTEEDKKIEEPENEDKLENKLEDKKVTEKQEDSKVEISLPEEKTPVVQIPKKEEKVNDLIKEPLKEKEKITYVIKEPLTDNKEVNKTKAQKDKDNNNQVISKKKEKKEEPEEKKEAKSEQGIQASNVFAIMSGLFVLFLVLKSNKEWGLast
1 -124.000IDP05036 hypothetical protein BA_1663 [Bacillus anthracis str. Ames] BA_1663 [Bacillus anthracis str. Ames]  ali  100  1MKNVKFFLMSWLCIHVCLLFPLQSKAEEQNVPEQNINEVNVQEENKEVQEQLEQVEMKQDKEEQQEAKNEQETEKKIETDQGVITVNKPELKVGEEVLVTIEPKEKNVQSIKGILRLPKNGDQYEQERMLSFKYEEETKRWIANYKVETFDLQGDWNLQLVQSYKENEKEELVENEVKVPLIHINNEMPTLDKELPKLHKVTIDEMKGNVIERKQGDSIRVRVKATDVESAVKEVHVTLKGKENKEITFLLDYNKRDMDWQKVFEITDALPSGTYELLVEVVDAAGNKLIEASEYVVSVLEQKTEEDKKIEEPENEDKLENKLEDKKVTEKQEDSKVEISLPEEKTPVVQIPKKEEKVNDLIKEPLKEKEKITYVIKEPLTDNKEVNKTKAQKDKDNNNQVISKKKEKKEEPEEKKEAKSEQGIQASNVFAIMSGLFVLFLVLKSNKEWG 450
2 -24.300IDP05125 putative lipoprotein [Bacillus anthracis str. Ames] BA_4310 [Bacillus anthracis str. Ames]  ali follow..  13  1MK--KLIMT--LFIAMLALAGCNTNKEE------------------------------------------PKKEQKLEAVKVAVQTNPKEIKPGEKTEVQALVTQGKEKVTDADDVKFEVWKAGDEKHEMLEGKHKGKGVYAVEKTFET---DGVYHII-AHTNAREMHVMPEVKVAVGNAKVEDAKKENSDHGAGHGDHKSDTMIHLMAGDIKANAESTMKVHLKQKEEALTEVQLEIWKDGVEKHEFIPAKEGNKGEYETKHTFKE---NGSYKVKVHVKKG...................................................................................................................................................................... 233
3 -16.400IDP04348 two component regulator [Clostridium perfringens ATCC 13124] CPF_2547 [Clostridium perfringens ATCC 13124]  ali follow..  10  66...................YMIMVQGRK---------EDSNKPFDYKVTEGVNVKRTVHGLQDEMNKDEINKDEIKEEKLIKGIYLNKDVFNVGEKAELKVDSNNENIM------------SGKNGWQLIKDYTLENKLNYTIN-------ESGQFEFL-IECKKTSSTNTT-------------DDYATVIFTSKEFVKPEIINFINLSEKLIVNSELTFEVEANFEDERTALYKFVKISPDGSRTCIQDFSSSRIVTFKEF-------KEGRYKLLCLIRDMYSNKEFDDRAVMVYDIKPYEPLQLRSFTTDLSSPQEKGEVIEIKAVIDGGSDILYRFKIDGEISEDTGYTRNSTLK--NAKKEGNYRITLWAKDESFIGDYEIESKLDYKIEKKVKKPIKITELIFDRDKTPLINEVIKLRVSEFIPNEKGNYQLDVRVKDK.... 478
4 -15.900IDP05407 conserved domain protein [Bacillus anthracis str. Ames] BA_1485 [Bacillus anthracis str. Ames]  ali follow..  1...MKNLVIGLVALLFVVVGGFYIKKYQETTETVGDVQ--------------------------------------------EVKWDVSNGKGNEKADIVFQLLNNKSSEVNDQIRAVIVDGQLKHVQQTKPTFA-GNGSYKVSSKIAK---DEGYTI-FLYEDKNKSVQSFAKKDFGKEIDEKNKKKVKFPIDSVLTKKIGEYEVSLLFGALHPNEPVTLTFQFQAKKGEKLKLHAERGEDETRENFLYAIPVDTDEQLQYRITFPA---EGTYKIIVQVQKRKNS................................................................................................................................................................... 257
5 -15.500IDP05700 hypothetical protein lmo2467 [Listeria monocytogenes EGD-e] lmo2467 [Listeria monocytogenes EGD-e]  ali follow..  17  252...............................................................................................................................................SYEDTTVESNTAYTYT-VRAKDFAGNKS----TLSNSINVTTKEVPAVDNEAPTAKSLMSHGQT--------DTTIALCWQASTDNVEVKNYEIYRNNTKIATST------------KTMFEDTKLASNTSYNYKVYAVDTSGNRSLVSNEITIKT....................................................................................................................................................... 383
6 -13.500IDP05411 putative chitin binding protein [Bacillus anthracis str. Ames] BA_2793 [Bacillus anthracis str. Ames]  ali follow..  13  268...............................................................................................................................................HFIDKKLQPSTEYSYT-VKAIDAAGNAS-----KESAKLTVKTTVEAPDTEAPTQPK---------HSMGTTTSSVDLMWSPSDDNIGVGHYDIYRETEGSMKKIATSN--------TTSYMDKNLLPNTTYKYVVKAVDVAGNESVQSDIFTITT....................................................................................................................................................... 402
7 -11.000IDP05615 putative lipoprotein [Bacillus anthracis str. Ames] BA_5522 [Bacillus anthracis str. Ames]  ali follow..  21  33................................................................................................................................................................................................EQHKKNTPLKIDEVKINT---VNGKTLMVDVKAKGE-----KLTYAYYIYKGEEIVEKIWYKPEN---SLKYEVKE---PGKYKVKAYAKDANKKIDSVYTN............................................................................................................................................................ 120
8 -10.000IDP05162 hypothetical protein BA_1701 [Bacillus anthracis str. Ames] BA_1701 [Bacillus anthracis str. Ames]  ali follow..  12  59....................................................................................TIKVTGLVTGDIVKVYDAASKGKELGTTKV----------------------AENATDATITGKDLLAVAGGTVY-VSVQSKDQLES----------PRTAKKYDTQVSLAPAVKNIVILNNDDADDIVESGDVVKV-YGEATGGEVIEKATV-----------------QGNKTA--VNVKIPQLGIEAGKVYVTVTKPNKDES................................................................................................................................................................. 215
9 -9.310IDP06525 gene: fms17; LPXTG family cell surface protein Fms17 [Enterococcus faecium DO] AFK58157 [Enterococcus faecium DO]  ali follow..  1MKKLLCLMLQLLVLLPLALLPHAMSAEESGEDVVEFVLHKRMIRDIDYNDQFEYHENDGLAISEEAGETADIISQTVP--LNGATFAIYDMTD----YYHEKKAAENMTPKEFVQQIAETNRNNIRQLITEERLVQIGTSVTTGKDTVGGLGDGIARIKAPKKNQDRDAVYLIFEESIDP--EVGLDVDIDQTAIPIAAILPIYHPTESTEEL---QEIHIYPKNVGYLRDPYFFKYGRQRGTTEKGKPLE----------AVFALYQMIEGGKYYLDMAPANDLKNQWIKPADNDPLNDKNVSKFISDKEGLVTTGQRFLPSGTYYFEELKGVEGYEMDEASKRIEVIIPEFWVDAKGQPQYVVVNGQEMAELESGKVPVSAYESATPRVYNETVKETTDKPKEPSGPSNPGQSGKWSVFPQTNEARTLISLLGILLLLGAVGEKNE.. 437
10 -8.820IDP05695 hypothetical protein lmo2080 [Listeria monocytogenes EGD-e] lmo2080 [Listeria monocytogenes EGD-e]  ali follow..  12  2MTGFKKVILPVLLV-VLFLAGCNQAEVPALVLDGTITDTSLLENNNELTVNGTLTWNGEKNDYASEVMITVSSNTAVTNATTGKAMKLADIKEEDTVRAVFP............................................................................................................................................................................................................................................................................................................................................................ 102

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.