current user: public

If you have questions about the server, please let us know.

Query: IDP05111 putative phage-related cell wall hydrolase [Clostridium difficile 630] CD2187 [Peptoclostridium difficile 630], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .
# Score Template Links and tools%idFirst MKNKKFIVIILIISILIGVLVKEYSSREIKKDDINVSKYIKYADLASKNNAQVNWKYVASIVAVLNKNNLKNVKDSQIQEVSDLFVKNFSKNNKINKLSDILDELEFSNRQKRLVDNYIDNLKDYGIKPERLKSDTKYMKFIDEIKTEAIQNYKDYKILPSITIAQAIIESSWGKSTLAKQYNNLFGIKADAYWKGKSVTLETKEHLDTIIDDKFRIYDDKNESIKDHAKFLATNKRYKNNGVFDAKTYIYQAKALEKAGYSTAKDENGNSIYAARLIELIQQYNLQLIDSEIQSEMLast
1 -109.000IDP05111 putative phage-related cell wall hydrolase [Clostridium difficile 630] CD2187 [Peptoclostridium difficile 630]  ali  100  1MKNKKFIVIILIISILIGVLVKEYSSREIKKDDINVSKYIKYADLASKNNAQVNWKYVASIVAVLNKNNLKNVKDSQIQEVSDLFVKNFSKNNKINKLSDILDELEFSNRQKRLVDNYIDNLKDYGIKPERLKSDTKYMKFIDEIKTEAIQNYKDYKILPSITIAQAIIESSWGKSTLAKQYNNLFGIKADAYWKGKSVTLETKEHLDTIIDDKFRIYDDKNESIKDHAKFLATNKRYKNNGVFDAKTYIYQAKALEKAGYSTAKDENGNSIYAARLIELIQQYNLQLIDSEIQSEM 297
2 -93.600IDP05623 putative mannosyl-glycoprotein endo-beta-N-acetylglucosamidase [Clostridium difficile 630] CD1034 [Peptoclostridium difficile 630]  ali follow..  37  16.KRVKLLFKKIFITVFIVASIVAIFNITKYFEELY-------------KVRDLKSTKIEYYMDVADEAGDGKVQLSWKALLAIDMVIHDEDLSNIKKKDKVLSELKFDSSQKSRARKYMKDLEYTYLGNKQLDSSDEKIKFIKKLEDSAIREYIDYGILPSITIGQAILESGWGNSKLTKQSNNLFGIKADKAWKGKSVEISTSEHYNEKIVASFRSYNSLQDSVKDHSLFLINNKRYRKHGLFEAKDYISQAQALENAGYSTAEDKKGNRIYAELLIDVIRSYNLQLIDNKVETK. 324
3 -66.500IDP05244 hypothetical protein lmo2203 [Listeria monocytogenes EGD-e] lmo2203 [Listeria monocytogenes EGD-e]  ali follow..  32  23....................................................................................................................VQAEAAGTNQTTVSQAGMTLSQQQFIQSIANDAQDLQKEEKILTSVTLAQAILESNWGKSGLSTSANNLFGIKG--SYEGSSVSMGTQEFSSGHTQADFRKYPDKKASLVDHAQLFVNGVSGNASAVIGETNYKEAAYAIQDAGYAT------DPAYAEKLISTIENYNLDQYDQIYDTVT 201
4 -58.100IDP05328 GW repeat-containing surface protein [Listeria monocytogenes EGD-e] lmo2591 [Listeria monocytogenes EGD-e]  ali follow..  36  19..................................................................................................................VVSINVGAETGGSRTAQVNLTTSQQAFIDEILPAAQDGYRDGKLLTSVTLAQAILESNWGESGLSQNSKNLFGIKG--TYKGKSVSMGTMEA-SGSTTANFRVYPSWKESIEDHTALITENARYQD--AVDETDYRKALQAIKDGGYAT------DPDYVSKLVAIIERYNLDKYDVIYDKI. 189
5 -51.900IDP01929 hypothetical protein lmo1076 [Listeria monocytogenes EGD-e] lmo1076 [Listeria monocytogenes EGD-e]  ali follow..  26  1...........................................................MIKKVFHFILVLMLSVSIIPLFHAKAAETTNGVDSSEQEDNTEVAREEMPPESDDAMAALVVPQTRNSFLRAASTPTFQQTFINSISTQAMDLCKKYNLYPSVMIAQAALESNWGRSELGKANYNLFGIKG--SYNGKSVTMKTWEYSDSQINANFAKYPSHKESLEDNAKKLRNGPSWDSSYWRENAKTYKDATAWLQGRYAT------DNTYASKLNTLISSYNLTQYDTLYDT.. 248
6 -15.000IDP91904 endo-beta-N-acetylglucosaminidase, partial [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100000777 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  20  446........................................................................................................................................INNSLLENKGATFKEAEEHYHINALYLLAHSALESNWGRSKIAKDKNNFFGITA----------------YDTTPYLSAKTFDDVDKGILGATKWIKEN--Y-----------------IDRGRYAS------DPYWGEKIAS-----VMMKINEKLGGK. 572
7 -11.800IDP05248 autolysin [Listeria monocytogenes EGD-e] lmo2691 [Listeria monocytogenes EGD-e]  ali follow..  15  1MQKTRKEILEALQEEKKNKKSKKFKTGATIAGVTAIATSITVPGIEVIVSADETAPADEASKSAEANTTKEASATATPENTAKQTVGPQQTETKEQTKTPEEKQAATNQVEKAPAEPATVSNPDNATSSSTPRSGATVQSFIQTIQASSSQIAAENDLYASVMIAQAILESAYGTSELGSANYNLFGIKGAYNGQ--SYTKQTLEDNYYTITAKFRKYPSYHQSLEDYAQVIRKGPSWNPN--------------YYSKAWKSNTTSYKD-----ATKALTGTYATDTAYATKLNDL 293
8 -11.500IDP91328 ribonuclease G and E [Vibrio vulnificus CMCP6] VV2_0290 [Vibrio vulnificus CMCP6]  ali follow..  12  3.........................................................................................................................................................VAVVVLSLLALGVIVKNSKSNLVPRGVRANNPLNIERSNNWLGKV---------TPSVDKRFETFSAPKYGFRAGARTLRTYQNKHGLNSIRE------------HRFAPSNENKK............................ 105
9 -9.380IDP93901 type III secretion system effector protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007715 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  11  25.....................................................................................................................................................SSAAIRWDVPEIILEAIIINESGGKPDARNINKNG-YGLQINTINIDPLKSQGIIKNKQALMQPCTNIEAGLSQKFKKHGYSWRAVGAYHSETAHYRDKYASKINSGPDFAQRNASLLRSTPTY........................ 158
10 -9.270IDP02784 putative transglycosylase [Salmonella typhimurium LT2] PSLT072 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  18...............................................................................................................................................HAADCFDLAGRDYKIDPDLLRAISWKESRNRANAVGINPVT-SGL---------------MQVDSQHFNELARYGIKPEQLVSDPCLNIYTGAYYLAIAFRKWGVSWTAVGAYNAGFKKTPLQDARRLDYATDVHRIWIAIK............ 146

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.