current user: public

If you have questions about the server, please let us know.

Query: IDP05117 putative collagen-binding protein [Clostridium difficile 630] CD2831 [Peptoclostridium difficile 630], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930    .  940    .  950    .  960    .  970
# Score Template Links and tools%idFirst MKKGNRKALLISLIMILSMVVSTIYPTVSYASELGENSQIQSGSTNSSTGEEKESDNKKPEQTPEKDKATDNKKPEQTPEEEKPTDNKKPEQTPEEDKSTDNKKPEQTPEGEKPIDNKKPEQIPEEDKSTDNKKSEQALEDEKPLDNKNTEKTPEEDNLLEDENLLKVLEEELNEENEDYGFVVKINNNTIETESMKKISFNLTYTPTSKGIQAGDSITFKVPDVFNKVNLDYTSECFDKTESNGEYTLTFRELPNGQSVMQGKIGLEAYVKKVDEDTNAKIHIETTGKIESGSGDIDVEIKPGDKTDVPDAKGTLKKLVEGKKSTTVFMPVKNKDINYSIQVNEKQEELKDIILYDELPEGLTLINGSVSVVTSDGKEVSDFNIEQSKNSISVNFGNIDKSYTVKYKARISDKNAKHGNKYKNVARIESDGKKIQEDDATVSIFDRGDDYLLTKGHSGATNITQVGQVINYQISINDDKSPISNVVITDNIPEGMRLTTSGEAGHDFRVVEIPMNGSWTPWSKEKIANNISYKVEEKRNESGQVDKVITGFTINLSKEEVESKFFIAYTLKVISIEDSYINRAVLDANNSEIDKNDEINFKKNSGLISAKKEVDKKVLNSSDNQIVKYKINMSTYGVYDAGQVNLLDEVNSVLEISNIKYSDNLELKKEAGDGKNTIRLVNKYEFKQIKEGEPVQSWVTFDANFTNVKVGETIRNVAQINGSSPPGVETTKQGYAFEAKKVDALDKNVLSGAKFNLEDAFGNIVVKDLVSDEDGIIQSSVKNPGTYYLVEIMAPRGYEKLKDKIKVEIGNKDIGRIVDIGNIENIRQENPPVNPPAPPNTDEPIVNPPVPPSTDKPRKPSSSSDTEDTIVINPPVPPSEDIINPPIPEVLNPPVPPSEEMIETPVKQIIPIPEVVKPSVSEEKNNKVKDDTLVNPPVPPKTGDSTTIIGEILLVIGAIVGLIVLRRNKNTNLast
1 -278.000IDP05117 putative collagen-binding protein [Clostridium difficile 630] CD2831 [Peptoclostridium difficile 630]  ali  100  1MKKGNRKALLISLIMILSMVVSTIYPTVSYASELGENSQIQSGSTNSSTGEEKESDNKKPEQTPEKDKATDNKKPEQTPEEEKPTDNKKPEQTPEEDKSTDNKKPEQTPEGEKPIDNKKPEQIPEEDKSTDNKKSEQALEDEKPLDNKNTEKTPEEDNLLEDENLLKVLEEELNEENEDYGFVVKINNNTIETESMKKISFNLTYTPTSKGIQAGDSITFKVPDVFNKVNLDYTSECFDKTESNGEYTLTFRELPNGQSVMQGKIGLEAYVKKVDEDTNAKIHIETTGKIESGSGDIDVEIKPGDKTDVPDAKGTLKKLVEGKKSTTVFMPVKNKDINYSIQVNEKQEELKDIILYDELPEGLTLINGSVSVVTSDGKEVSDFNIEQSKNSISVNFGNIDKSYTVKYKARISDKNAKHGNKYKNVARIESDGKKIQEDDATVSIFDRGDDYLLTKGHSGATNITQVGQVINYQISINDDKSPISNVVITDNIPEGMRLTTSGEAGHDFRVVEIPMNGSWTPWSKEKIANNISYKVEEKRNESGQVDKVITGFTINLSKEEVESKFFIAYTLKVISIEDSYINRAVLDANNSEIDKNDEINFKKNSGLISAKKEVDKKVLNSSDNQIVKYKINMSTYGVYDAGQVNLLDEVNSVLEISNIKYSDNLELKKEAGDGKNTIRLVNKYEFKQIKEGEPVQSWVTFDANFTNVKVGETIRNVAQINGSSPPGVETTKQGYAFEAKKVDALDKNVLSGAKFNLEDAFGNIVVKDLVSDEDGIIQSSVKNPGTYYLVEIMAPRGYEKLKDKIKVEIGNKDIGRIVDIGNIENIRQENPPVNPPAPPNTDEPIVNPPVPPSTDKPRKPSSSSDTEDTIVINPPVPPSEDIINPPIPEVLNPPVPPSEEMIETPVKQIIPIPEVVKPSVSEEKNNKVKDDTLVNPPVPPKTGDSTTIIGEILLVIGAIVGLIVLRRNKNTN 972
2 -65.100IDP05223 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo0160 [Listeria monocytogenes EGD-e]  ali follow..  20  1MMSNLKKLAFLSVILLVNVIFQT-------------------------------------------------------------------------------------------------------------------------------------NFVKAATNYGSDFLKTVELLDAD-------GNPQTDFGYYDSIKVHYTWEPNSTNVKEGDTMEFVLPPELKIVTDGNTVGHVIAKKSTGQVVITFTDFVEKNSNISGYLDFWTNWDKSLVEGNENVPVEFPVNGTTETIDVGVGGKNQIDPD------------ESLYKYGWADAENPELIQWVVRVNYSKQNIQNAVYEDFIGPKQVVDFNSIKAFHGEGAEVPSSAITQTTDGFKVDLGNLTDSVKISYYTTSTDNGASPNYTNKGQLTGDNFIKQEIEVATPTS-------------GGGGGGEGTTGSVELTKTDDSSQKNPLEGAEFKLVNGAGATVQTG-----------------------------------------------------------------------------------------------------------------------------------------------------------------------KTNADGKLAISNLKYDTYQLIETKAPQGYVLDASPVKFTIDDTHQSLFVSK---------ENTAIKGSVSLEKVDRDTKSLLADAEFELQDKDGNTLKTNLKTDQKGKLTVADLLPGEYQFVETKAPTGYILDTTPLKFKISTEALNVTVTKENTKKPEIPKVPVPPKKPEKPDKI-------------------------------------------------------------------------------------ISEDSKQTALPKTGDSPLVNGWGLLLVAISASGLIALRRK... 565
3 -60.300IDP05655 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo0159 [Listeria monocytogenes EGD-e]  ali follow..  14  1MSKNGNFLAFLSILIVASTIFQT-------------------------------------------------------------------------------------------------------------------------------------TVVKAATSYGSQFLNTVELLDKD-------GVPQTDFGYYDNMDVHYTWSPNSTNVKAGDTMDFTLPSQLALATDGQVVGTATVKKATNQVTLVFSDYVEKHSDVKGELDFWTAFNQKVITGNETVDLVFPLENGTTVIDVEVGEKTPVSPTET-------------FKYGWVDASNPSLIHWVVRVNYAKVNIPNAVFTDIIGAKQTLNFDSIKAFHTAGAPISSTNFSATSDGFSVALGNLTDSVQISYTTTTTDGGKSTQYD-NTAKLAGTDFVTKQTSTWTPASGGGGEGGGTTGSVTLTKEDAKTKATLEFKL-VDSKGTVLQENITTNALKFDTYQLIETKAPTGYKLDTTPVEFTIGENNQAITVTKENTLNTTKLDAATKATLAGATFEL------QDKEGNTLQTDLKTDENGVLKVTDLVPGSYQFVETSAPTGYKLDNSPVSFEVIAGETDQTLEVGSVELTKLDSATKATLAGATFELQDKEGNTLQ----------TDLKTDENGVLKVTDLVPGSYQFVETSAPTGYKLDNSPVSFEVVAGET-------DQVVKVTKENTLEVGSVELTKLDSATKATLAGATFELQDKEGNTLQTGLTTDENGVLKVTDLVPGTYQFVETKAPIGYELDTTPVSFEIVAGETDPIVKVTKENTLVPPTPVPPTPVPPTPVPPTPVPPTPLPPVPYEPTVPPTKPEVPVTPKKTENSEDSPKTTPIRITQS----------------------------------------------LPKTGDTNSFAGLGVILIALSLSGLLLKRK.... 793
4 -41.500IDP06529 gene: acm; collagen-binding MSCRAMM Acm (Fms8) [Enterococcus faecium DO] AFK59905 [Enterococcus faecium DO]  ali follow..  13  1MKK---RNIILSMLFIITNITSLIPVHVYADAGRDISSNVTSLTVDPT-----------------------------------------------------------------------------------------------------------------------------------------------NITDGGNIKVKFSFDEKKQNIQPGDYLWINWPSEGNIRGEGFQKEI-TLTVRKDSAQVVFNENIKNLDSVEGWGQFEIQARNVTDTGEENTGP------------FTVTSGDKTATVNVTKPASGSSSSVFYYKTGDMLPEDTKHIRWFLNINNNGTYVEQVKISDEIQSGQRLDPSTFEINQIH-SATFNFSVTDNYIEITIPKNFVNRKIMVSYKTIIENPEQINFEN-FNKPAVDGESFNHTVKNISASGGVNGTVRGELKIFKYINDTEIGIPNVTFELRRADEQPIQGQSSILLTSNEQGEASIKGLQVGDYVVKEKEAPNWIDFDPLSSNELKFSINENDTEGVSLPIYNKKKVTNITATKIWNGGT-----------------------------TPRPSIYFKLFRASTNNWEPVPDAETKRLDNGITSVT-------------------------------------------------------WEDIQQYDDSGNEYTFKVQEVDQNGNDYVPSGYQKIENGLVVTNENKEVISVSGQKTENQDGKRPTTITVNLLADGQPIQHKEVSEKDDWRYRFTNLP-GQYTVTEDNVP-EYSTTIDGYNIK------NSYTPEKTNISIPGSHITPWKNFPEKTEREKIRNLFSQKLQIFAHTGESSEQRSNYISKRAVP---------------------------------------------------KQITNKSKSILPKTSSKKSSFAVIIGLLIVICAGIFLQKYKK.. 720
5 -37.900IDP05697 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo2178 [Listeria monocytogenes EGD-e]  ali follow..  12  380.......GYQVTYDRTINKPSDSLSYMSTQAYTVGDAGTLSSNSAYVYLTMTNYKHLEKKATYNGSTQSIDWKINFNFDQDEISPSTVLTDVLADNDVEYVADSLKNATNGSPIVGSDASSDWTTSAISANGNFNLTYKNTNTNAYEITYSTKITDFSDRKIKNEITDENGVSADATIAIQPDLLKKEAGTIDYFNNTMTWKITANSDRIKMGN--NITDEFSTGVKALKSYTVRAYTDNTNSVLLTEGKDYTIDKDVTPAGFYIQLIGDYASTDKKIVVDFVTDIDLSDVTKTIDNKASISIIKYVDEVTASMTPDPGMMTNGGKYGSYNSTTGNIDWIVSVNAMAKNYDNLIFDDAIPTGLTYVEGSLQYRNVAGDKNYPTKVDTTGNKLHLEFANENSRVFIKYSTKPNENWYFY-SYVQNTAKVSDNGVGEKSYSYQAYASKLF-----NAMTKTATIDPSFDNKVNWIVTLNNISAPINNPTITDTMKTGTTVVKSSFKVMNETTGEDIDSKYYDGSLPMTYKSRTTSISPAFTIGSGSGTATIGSLEITKVDKKDNSKKLTGAKFQLYTLEGDKAGQEATTDSDGKIVMDG-VETEAPTGYTISDEYKDGKEITVTADIATSVTIDSATKDAIAGAEFELQNADGTKVADNLVSNADGQNATGTKVKDNLTTNADGKLEVTDLAPGDYKFVETKAPTGYELDATPVTFTIEFNQATAVNVTKENVAKTGSVVLTKLDSKSRSNLAGAEFELQTKLGVSLKDKVVTEANGQLQIDNLAPGDYQLVETKAPTGYDLDATPVEFTIEFNQKAPIQVTKTNTMSTGSVVLTKTDGETKALLANATFKL--DEDNNVTENLTTDASGKLEITNLAPGDYQLIETKAPAGYELDTVPVDVKITEKNKAPIVVNPDKPVTPVKPTKPVDPAKKPTVKTSLPSTGDESPYGIIFTGLFASFMGLFLLRKSKKIN 1598
6 -36.800IDP06520 gene: ebpCfm; pilus subunit protein EbpCfm (Fms9) [Enterococcus faecium DO] AFK59016 [Enterococcus faecium DO]  ali follow..  12  1MKNHKKINVMLGVLFLILPLLTNSFGAKKVFAEETAAQ--TDLPDPLIQNSGKEMSEFDQYQGLADNVTQEFYAQRDKGASVDAAKQAVQSLTPGTPVASGTTDADGNVTLSLPKKQNGKDAV-KEEPKDGVSAAANMVLAFPVYEMIKQADGSYKYGTEELDTIHLYPKNTVGNDGTLKVTKIGTAENEALNGAEFIISKEEGTPSVKKYIQSVTDGLYTWTTDQTKAKHFITGHSYDIGNNDFAEASIEKGQLIVNHLEVGKYNLEEVKAPDNAEMIEKQTITPFEILANSQTPVEKTIKNDTSKVDKTTPQLNGKDVA------------GEKIQYEISVEGTQNKYTTFKLIDTHDAALTFDNDSSGTYAYALYDPVNYSVTEQTDGFTVSVDP-GGTLKFVYYMHLNE-KADPTKGFSNQANVDNGHTNDQTPP-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SVDVVTGGKRFVKVDGDSDQTLAGAEFVVRDQDSDTAATVFTTTSNGLIDVTGLKYGTYYLEETKAPEKYVPLTNRVAFTIDEQSYVTAGQLISPEKIP---------------------------------------------------------------------------------------------------------NKHKGTLPSTGGKGIYVYIGAGVVLLLIAGLYFARRKHSQ 624
7 -36.300IDP06539 gene: fms13; LPXTG family cell surface protein Fms13 [Enterococcus faecium DO] AFK58158 [Enterococcus faecium DO]  ali follow..  11  1MNKKMIVTGMSVLLLVTAGIGIFGNGKLVKAEEVAQKPSEVT--------------------------------------------HKKGFSSVPEERPNSGLVSTDFGEENIPGVDFDLFDVTEVYYDLIRDNPLTPEREDGLNSAEAIEWIQKRHTESWFLKYRLTSIDKQTTNEAGEAVFSTVQVTEEAPSSRDKVYLFLETYSPAHISRIASPMVVMMP-------------------------------------VMMPDMVDGVWDGSTWKDTYNTDVHLYPKNEIREADKQMNVEESDLRQVTIINEA-----GEQETISYIDLERGKTASYTITAPNGSAVIKNYKITDTPTVGLTYYDQEIEVRAGETILTKGQD----------------------YIVEVVSNGFVVTILTEENGVAKVDTLGRLADARGGDL------------------------TITYNLKVSTE----------------------------------------------------------------------------------------------LEADDFHNNTAVIEIG------------------------------------------------------------------------------------------------------------------------------RNDEFDYEEGVEPPEKVTTGGRKFEKYDASSSELLKDARFELWNEDRSEYATEFVADGNGYFEVQGLDYGTYQMKETMAPEGYVLPTGEAAFTEFIISYGS-------------------------------------------------------------------------------------------------YNEEIQIVGVENPGPERVPNMKRGSLPATGGNGLLAFLLIGISLMIGAYSWYRKSKMKS 563
8 -34.500IDP05461 conserved repeat domain protein [Bacillus anthracis str. Ames] BA_1618 [Bacillus anthracis str. Ames]  ali follow..  1214IPAGGFTTIVFQIGAVQNSAVLQYNFIADPNSPPVVRNSASNIVTTQINTANIVATKLTSTNFADVGDVITYATILTNNGNIPASNVTFTDIIPA--PNTVTINGVPIANANPANGILIGTIGANSSRTVAFQVFVPTIPSANPIANQSSTTFQYTYDPSKPAVMQMVASNTVQTTINNATITSVKSADKQFANVNDIITYTTTLTNNGNTLASNIVFTDAIPSGTSFIPNSVTVNGTTLSNANPANGIAIDPINPNAN----IISFQVQVNSIPNPNPIPNQSNTTYQYVVNPNLPPASSNTLSNVITTQINNA---TIIATKSVNTPNAAIGDIVTYTIAVNTGNIPASATVLTDGLGPGASFIPNSVTI--------NNVSQPGLDPSLGIHLDDISPEGTTFITFQVKILAIPPSGTLTNNALVNYTETPAVGSTVTNTTVTPIVDATLVINKNASTTFATIGDTITFTSVVNTGNTTANNIVFTDSIPNGTTFVPNSFKINGVTV-----------------------------------PNTNPQNSINIGNLNANASVTLSFQVNITTNPNPIPNQSSLQYRFSRTVQSNKTFTQVNSASVIATKTASSAFAAVGD--TITYTTTLTNSGNTTANTPVFIDILPAELSFVPDSVQ---------INTIPQLGFRPDTGVPLDSIPVGGTITISFQAIVGSIPAINPTLNQSSTTYSIIVDPTQPPVTEIATSNPTLIQINEAIIQATKSVDRLFNSFLTYTVLLENIGNTTATNI-----IFTDP-IPNHTVFIEDSVR...................................................................................................................................................................... 1989
9 -34.400IDP05371 conserved repeat domain protein [Bacillus anthracis str. Ames] BA_3601 [Bacillus anthracis str. Ames]  ali follow..  10 1207IPVGQTATVTFQVTVIRNQSNITASFLINPANPPITTVTNSNFVVTQVNTAQLNIQKTSSVQQAALGETYTYSVVIRNNGTVTATNVSFIDPIAPE-ANSVTINGTPQPGFDPNVGFPLPNIAAGTSLTVTFQVTVIAPSTRGAVLNTASTFLLNPLQPPVTTTNSSNTTVVTIPLPPPGEVTATKTVDVAAGAVGDVLTYTVLISNVGIIPVADVFFQDVIPEGTTFVEGSVTIGGVQQLGLNPEIGFTVTPLLIAGGSI--EITFQVTITEIPDNEVILNDADVTFTSQPNPQEPPITETILTNLVVTTINIA---FVFPLKLVDKEVATVGEILTYDVLINFGTVPATNVQYSDVLPSSIAFEPNSV--------TIDGVLQPGFNPNNGFPLPDINPGESVEVTFQVTVVSVPSNGTIVNTANVTGSFVLVPGEPPVIVTGPSNTTLTTVNRKQVNRAATLVGDVLTYTVQINTGTVTANDVQFIDTISAGASFVPNSVTINGALQPNLN-----------------------------------PITGFGVGDIPVGETVVVTFQATVTNASGTITNVANITGSCTVTEPSNTTITSINRGRFSVIKSVNKEATRLGD--TLTYSVQVTNTGTVTATNVQFIDVPSPSLEFVPGSVQ---------INGIPQVGLNPFIGFSLPDLAVGDSVLITFAVNVIAVPPSSSIMNTARVTGDFELIPGEPPFTIT----NSSNTTVTPVNRGSLDMQKE-GETVTYTVRILNTGTADAMNV-----QFIDV-LSPEAVFVPNSVT...................................................................................................................................................................... 1983
10 -34.400IDP06525 gene: fms17; LPXTG family cell surface protein Fms17 [Enterococcus faecium DO] AFK58157 [Enterococcus faecium DO]  ali follow..  14  227...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KYGRQRGTTEKGKPLEGAVFALYQMIEDKNVSKFISDKEGLVTTGQLPSGTYYFEELKGVEGYEMDEASKRIEVIIPEFWVDAKGQPQYVVVNGQEMAELESGKVPVSA--------------------------------------YESATPRVYNETVKETTDKPKEPSGPSNP-------------------GQSGKWSVFPQTNEARTLI-SLLGILLLLGAVLLIKKERGEK 435
11 -33.400IDP05077 hypothetical protein lmo1115 [Listeria monocytogenes EGD-e] lmo1115 [Listeria monocytogenes EGD-e]  ali follow..  1MKTKSKSTYIMVLVTICGTFFTS------------STSVHASDLVLNEPTAYSYTGVSPHLGYAITHNPIYVMKMDGKKVFCVESGIFTTTGGGYIPESYISPKKDIQSHYDYVVTQVMIWEELGDQYVSSTIPNYQQRKAEIMAMVNRHDTLPSWHNQEVKVTVGESITLADSHGVLSGMSLESNNTNATLQQDGNNITITPNANSNDGSITYRKVPQYTKPQHQTLVEFHLESAKQATVKVDGNVQITKVDEETGRPLPDTTMKFEYNGTSTELVTDSEVKAPNGYVNKGVSQVVTIEPNKTIELTFDNKEQLGIATLTKAGEEAKEIEVTESEYGDVHTFKYNANVVAGVTYR--IEATQDIHSVDGTLKAKKGDTVATVTTDEKG---QWHSPNLYGEYQAV-EVSAPAGYILDTRPIPFSLTYAGQEVELASTAIKATNEFQTLDLRLFKDEESILSWNNNQP--------EIEVIQGQEKVFGVFTREAQALTDEVHVPANALLGYQTVSDGVASFELK---------------------------KYYLKELEAGTSHVLNDTEYDFKFTAENNNATYPIYIYQDTVAVGNETMLKIARTPIINKEFIIKKLNEQAIFDKESGVEFNYDGLGTGAIFTLENEDNEVIQ-----------EVTIDKDGQGNFKNIPVGTFYLKEKSASSTHYLMSEKVIRIESTKDGETSSTDEEPTILLEIENDLKKGTAELTKKDVSTGELLPNTGIRILDEEKNTI-AEGRTDDKGIYTFEKLPAGKYYFQEYDAPTGYQLDDTPMLFEITENGEVVKCEMTNNKIPEKITSLPQTGDTTNITIFALGMLLSVSTLGVLYFRRKKAKIE........................................................................................................ 873
12 -33.100IDP06530 surface protein [Enterococcus faecium DO] AFK59398 [Enterococcus faecium DO]  ali follow..  14  16...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................AESALTFTTDTEGSISVNGLIDGNYTLVETKAPDGYQLTNPQKETTFIVKNGKLQQTTGIIHGADEANLGNPNGVVNRENTTTDNTITVENVQNYGDFHFIKQDVNTQEKLADAEFSILRAKDPTVKVKLISDSEGKFSIEGLKQGAYCLQETKAPEGYALPKNEAAYTEFTVDDDPTTSDETT------------------------------------------------------------------------------------------------------------DNQPKGILPSTGGMGIIVFILVGTALVGGAVIYFKKRHQET 269
13 -30.600IDP05567 pepdidoglycan bound protein [Listeria monocytogenes EGD-e] lmo2576 [Listeria monocytogenes EGD-e]  ali follow..  11  1MITVKKYPMLLMSFLIVGMIIFCVPHHAQATELDNIIDGVQILDRDGKPIDSESDSDRVVDSQEDIVVVYNWSIKDNQ---PVHAGDTVHIQIPKEFKIYTTVQGELVISDGGASCGEFEITTDGM---NDYVENHSISHGIVEVYTNFDLEELDGETPTTIVFPISENDSEEFTIKIKPDTTNAFEKKGSTVQNAQVIDWEIKINQELATHEN--SVEDFPGNGQKILFDSFEVHEMNMHIDGTYEIGAKVDPSEYTVTKINNTSGQTGFRENPIDSAYQITYQTEITDFNKATFSNTATFNSDETEEVMDSDVVIPRDPIIQKYPLLFDTTSNKISWKVEYNQGHYALDNSVMVDTYIDEQSFGGITRIVNGDTGIPLLPTEYTVTDMG------PDDGYYTIYFETIVPEGTTSGDNEYTNNATIKTDTAEASDSDTKWI------DKVIDADGYKNGVFNYKTGEIEWKLIFNDSSKLISKPTIEDSLNSGQTFIQDSIEIHKIDLSATPQVGELIPPENYDVTEGATFDLYANDEKVDTQTTDKNG-DYTLKEVSAPEGYTLPTAVKTDKATGATLAGAEFSLYDKSGAELQNGLTTDENGELTIHNSVESGQVDAIEGEAVLTKVDSETNAKLSGAKFNLLNDSGEVIQTNLVSDENGASNLTTDANGEITVTNLAPGKYSFKETKAPEGYELATDVWEFTIAPNQPEKITITAENT---KLAPIPDAGSVKIIKQDSENGVRLAGAEFSLIAENGETLQTNLKTDEAGELEVNNLAPGNYRIQETKAPDGYQLESTPWQFEIVANDTSQVTVIAENAKLEPDVAEIKTDSETGTRLSGAVFSLLDESGKVIQANLTTDENGEIFIDGLTPGNYSLKETKAPDGYELAEQPWNFQIVKGQVDAVIIKAENSPIIANGAISFEGDETDKEVTKLPQTGDKTSFPRVILGGSAVLMSLLYLRKKSS.. 1530
14 -29.900IDP02471 hypothetical protein lmo0880 [Listeria monocytogenes EGD-e] lmo0880 [Listeria monocytogenes EGD-e]  ali follow..  15  1MKK--RWLVFAIICLIITGFLSP--------------------------------------------------------------------------------------------------------------------------------------KAEAATDYGSSFFTNVSLQNQN-------GEQATNFKENSKVRVAYDFVITQ-PVASGETMTLTIPDQLKLINYGG-IANATIDQVTGTITLTFTDYVNTHTDLSGSLFYNATFNSKNIQTDQVNPIAFP--VKNTTQTVTPYISKVNSGGGTGSPTIVFKQGRMDDK-------DLSILHWTVTLNNALTPIDNAVYTDTLGSGQNLLGSATIKYRDANKKVIATNILDADRNFELSIGALNQSVVITYDTKITT----KQKSYTNKATLSGDNLDAVSRNATVN................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 300
15 -29.400IDP05538 putative collagen-binding surface protein [Clostridium difficile 630] CD3392 [Peptoclostridium difficile 630]  ali follow..  12  184..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SGEGQELGQFWAKLNVGNAKLQKTDGNGNYSIAGATYGVFDKDCTKQLATLTTDKNGNTDVIEVKAGTVYIKELSAPAGYKVDKTIYPLTIKAGETATLKVSDTPKVTDTLVELFKIDMETQKDNPQGNASLAITKLADAYKVSGDSFYMQDGKAVLPLGTLTVEETKAPNGYLLDGAYMQAGDKSEQIKGL-TEDGDLAVLTGSNQFSVSDKVIRGGVKIQKRDLETG......................... 466
16 -28.800IDP05502 putative collagen-binding surface protein [Clostridium difficile 630] CD0386 [Peptoclostridium difficile 630]  ali follow..  12  186................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................EGQELGQFWAKLNVGNAKLQKTDGNGNYSIAGATYGVFDKDCTKQLATLTTNENGNTDVVEVTTGTVYIRELSAPAGYKVDKTVYSLKVEAGKTATLKVSDTPKVTDTLIELFKIDMETQKDNPQGNASLAITKLADAYKVSGDSFYMQDGKAVLPLGTLTVEETKAPNGYLLDGAYMQAGDKSEQIKGL-TEDGDLAVLSGSNQFSVSDKVIRGGVKIQKRDLETG......................... 466
17 -28.000IDP05452 collagen adhesion protein, C-terminal [Bacillus anthracis str. Sterne] BAS5207 [Bacillus anthracis str. Sterne]  ali follow..  13  4.................................................................................................................................................................................................................VKLSLLAYALAIISKTITESQTTSATVTAKNSLTKGGIELTKVNAADEKETLEG-----AVFKIVNRDTNEDARTNLV---TNSEGKLVVDDLRPGNYKLIETKAPTYYDVNVEPIEFTIEKGQQTLLPLTFKNSLTKGKVK-LIKEDDVESSIALAGAVFTLQDANGTEIAKDLKTDEHGVLVIP----PGDYQFI-------ETAAPEHYKLDQTPIKFTIERSQTKHVFVTATNSLTKGSVELIKVDDVEENTTLEGAVFKI-VNKDGHDVRTDLTTDKLPPGDYEFIETKAPTHYDLNETPIKFTVKKGQEKIASVTATNSLTKGAVELSKVDDIDGSTLKDAVFKIVDMNGNDVRTDLTTNKDGKISVSDLRPGDYQFVETKAPTHYDLNQTPINFTVEKSQTATASVTAKNSLTKGAVELTKVDDIDGTTLE---GAIFKIVDQNGNDVRTDLTTDKDGKISVSDLRPGDYQFVETKAPTHYDLNQTPINFTVEKSQTATASVTA--------TNSLTKGAVELTKVDDIDGATLEGAVFKIVDMNGNDVRTDLTTDKDGKISVSDLRPGDYQFIETKAPKHYDLNQNPINFTVEKSQTATASVTATNSLTKGAVELMKVDDIDGTTLEGAIFKIVDSNGHDVRADLTTDKDGKISVSDLRPGDYQFIETKAPTGYDLNAKPIPFTITKGQSQVTSVTALNSLTTGSMELTKVDIDHNGT..................................... 721
18 -27.500IDP92699 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus USA300_TCH1516] YP_001574462 [Staphylococcus aureus subsp. aureus USA300_TCH1516]  ali follow..  2INRDNRKSILVGTTLIFGLGNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEE-----------------------------------------------------KNNPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDGKDNVAAAHDGKDIEYDTEFTIDNKVKKGDTMTINNVIPSDLTDKNDPIDITDPSGEVIAKGTFDKATKQITYTFTDVDKYEDIKSRLTLYSYIDKKTVPNETSLNLTFATAGKETSQNVTVDYQDPMVHGDSNIQSIFTKLDEDKQTIEQQIYVNPLKKSATNTKVD---DDYGNIKLGNGSTIIDQNTEIKVYKVNSDQQLPQSNRIYDFSQYEDVTSQFDNKKSFSNNVATLDFGDINSAYIIKPTSDGELDIAQGTSMRTTDKYGYYNYAGYSNFIVTSNDTGGGDGTVKPEEKLYKIGDYVWEDVDKDGVQGTDSKEKPMAN-----VLVTLTYPDGTTKSVRTDANGHYEFGGLKDGETYTVKFETPTGYLPTKVNGTTDGEKDSNGSSVTVKINGKDDMSEPKYNLGDYVWEDTNKDNEPGIKDVKVTLKDSTGKVI-GTTTTDASGKYKFTDLDNGNYTV-EFETPAGY.............................................................................................................................................................................. 790
19 -27.100IDP01796 cell wall surface anchor family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA5258 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  13  259.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................KVQNTTVLLQRNSEKISTDLVVNWESVGSLKIMKLGEKKEVLKGAVFEVSNE-------------NFKQNVTTSDKGIAELGNLPIGIYSVKEIQAPAGYVLDRSVKKIEVKTGETAV----------LELKNENVKGELEITKVDVADNTKLPNAEFTIYNEQGKEV-VKGKTDEKGVAKF-KLPYGKYTYKETIAPNGYVINEETFAFEIKENGEIIKHIVQD--KKVEGELEITKVDVADGNTKLPNAEFTIYNEQGKEVVKGKTNEQGIAKFKLPYGKYTYKETIAPNGYVINEEKFGFEIKENGEIKPNKPTPNGEVKPSADVKPMQQPSTHNEVRLPATGGVSNQFTSLFGISFIIAGAYVLRMKNRKE 626
20 -26.800IDP05436 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo2085 [Listeria monocytogenes EGD-e]  ali follow..  11  1....................................................................................................................................................................................................................................................................................................................................................MQRKLIGSFFILMVLL---------------IIGSTSEKVQASPTSSNG---WQLKWAIKNN---DFEDVDITDYGQNAGTTNVWMVNQAGVDAWGTTNPTGNIEVWQNGNGYNVPAFSGNNFIELNSDGIGPVYQDIRTIPGSNLTWKNGETWGSFEGNYTVPAGQTITRLTDFNGDGIQQDSEEPAPGVKVDLLTKDGTFKESATTNNIGSYLFTDVLPGD-----YQVKFSLPNNDFIFSKANQGNDKSLNSKPDKT-GIASVNVPNLKSENFDIDAGITTNGKVEIQKLSGDKALSGAVYAIKDNSQSEVA-------------------KITTNQNGTGTAEGLPPGNYTATEVTAPLGYQKNTTPKKFTITYGDTNPVKLTFQNAEKTGSITIFKQDEANKKGLANAVFDVKSIDGTTL-KKVTTNSKGYALAENLQPGTYVITEVTAPPGYEKSANEIRVTIPFNPQKTINITFSDNKIMVPLKPTPTKGSTVVKVSGETTKITALPQTGDSSSSSTIFTG........................................................................................................ 547
21 -26.400IDP92687 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus str. Newman] YP_001331559 [Staphylococcus aureus subsp. aureus str. Newman]  ali follow..  11  2INRDNRKSILVGTTLIFGL-------GNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRN-------------------DSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDGKDNVAAAHDGKDI------------------------EYDTEFTIDNKVKKGDTMTINYDKNVPSDLTDKNDPIDITDPSGEVIAKGTFDKATKQITYTFTDVDKYEDIKSRLTLYSYIDKKTVPNETSLNLTFATAGKETSQNVTVDYQDPMVHGDSNIQSIFTKLDEDKQTIEQQIYVNPLKKSATNTKVD---DDYGNIKLGNGSTIIDQNTEIKVYKVNSDQQLPQSNRIYDFSQYEDVTSQFDNKKSFSNNVATLDFGDINSAYIIKVVSKYT------------PTSDGELDIAQGTSMRTTDKYGYYNYAGYSNFIVTSNDTGGGDGTVKPEEKLYKIGDYVWEDVDKDGVQGTDSKEKPMANVLVTLTYPSVRTDANGHYEFGGLKDGETYTVKFETPTGYLPTKVNGTTDGEKDSNGSSVTVKINGKDDMSLDT--EDTNKDGIIKDVKVTLKDSTGKVI-GTTTTDASGKYKFTDLDNGNYTV-EFETPAGYT............................................................................................................................................................................. 791
22 -25.200IDP06545 gene: fms18; LPXTG family cell surface protein Fms18 [Enterococcus faecium DO] AFK59452 [Enterococcus faecium DO]  ali follow..  1MKKPKNWRLLATLSLLCQTIGGSLGPTIAFADEITHPQTVT-DLAHQYAVEGTFSDGRPMSEVTVPHYAVYNGVKQ-EPGVPIYNEFTPGYEKNPLPDMSEKAKLVSVLWKEAGTDVDTHSIKRSDGSAVNIAAIESKINQAIADYQKKPSFHNSTVKTVLGQSTTVTDTNGLNLSEFDEVVENIANIDYRVNGNQLVIT---ANSKESGELTLKKSANTGTPVAYKM--------------AGQQTLMAGAIDKPNTYTIK----------------------------------------------------------------------IDVETEGSLKIKK----------VDK-ETGNVVPGTVFHLDFGKTLPAKDVTTDKEGAKVTITEKSVPAPYTIDTTPITATIKSGETISVTSKNTREKGQIILNKMGVETGTDLWNDKYSLAGNTFAIRKDSPTGEIVQ-EMTTDEKGHAETPKEIANALELGTYYVTETKASNGFVNTFKPVK-----------------------------------------ELNYVNQTVALVTSNVKGQNQEITGETTLTKEDKDTGNETQGKAEFKGAEYTLFTAKDGQAVKWSEAFKPELVKGTKASDETVT---------------------------TLDEKNQVAVKHLAINEYYWQETKAPEGYTLDETKYPVSIKKVDDNEKNAVITRD--VTAKEQVIRFGFDFFKFAGSAETGFNDLTFKVSPLEGTSTAYNEQLGFDGYGKFENLPYGDYLLEEVEAPEGFQKITPLEIRSTFKENKADYTKSEYIFTITEKGQKQPIKTVTVPYEKLTNKALTSLGTWKDGGKELTDLDSTELVDKLSYNLHEIKEDWYVVAQAIDVEATKAAQEKDEKKKVPTTPSAPEQPEIPTVPSDSQESSPTVKTFPQTGEKNSNVLLFIGFTLIFATAGYYFWNRRN. 1075
23 -24.900IDP06509 gene: fms20; LPXTG family cell surface protein Fms20 [Enterococcus faecium DO] AFK60478 [Enterococcus faecium DO]  ali follow..  1MNFKHSWTYVFPIMMMLGTLFGLKTANVFAEKVIVDPSNPIQNVKNNFIIPKDVPNAKTNITVNGASKVYKYHVDANKGGFTDDYVGLVEGNKKIRYPSFQKEYGETN-EGVTTNTKVNIDYGKIGTYNGKKVNIKLVLSNIHLYSDTLPWNLLDNNYTKTHFRDDGYKNTNGAMSKSKKRTVLWISDNLFSGIIYHSTQMNVQLV-SPVQFSGDTFISFNLNPAGGKSTDLKGEYAHYDKMNTTDWYVRKDTVLSEFKSFYNNLNVVGGHPGGSSKGQGTVSFKISEAIGSSNVQTWFTLSSATIFSVVPDQPEKTGVDKNGNNVNDKMLQVGDTIQYRIKQKDLLAVYDRFELIDNLPKEVNYVDAHVESGTNKKFDVSEVTYDKTKHQVKYAAKA-GETYELVINVKVNE-LANQNSVAKNQGTSIINKVEKDTNIITVYFPKIPVKEVQQNGKDVNGRNDNAGSEVQYLVTQDAASDHYKQFSIQDPIEARLTYKEGSAQV-----------------IDKSKGKDITSEGTLTYDSNSRTLKWEASADFLSNNLLDGREIQLIFTAKTPQSEKNIDNQAVVAVDNVSNKTNVVTI.................................................................................................................................................................................................................................................................................................................................................................................... 653
24 -24.600IDP05088 LPXTG-motif cell wall anchor domain protein [Bacillus anthracis str. Ames] BA_0871 [Bacillus anthracis str. Ames]  ali follow..  14  340............................................................................................................................................................................................................................................................................................................................................KPAAKKGNLQIKK----------VDENNENIVLKDAKFDVIDKENNVVDTVTTNEKG---IAEVKDLPGDYFVK---EISAPEGYIKIDAPVKVTIDNTNIIEFVIKNTKKLENGQLKLLKKDSESGQL--------AKFDV-IDKDGKVVETIVTDDKLPVGSYTLKEVEAPKGYELSSSSVSVDVEA----------NKVVTVDVVNKKIPEKVTGQFEVVKVDANDKTKLLSGAEFEVYKDGKKVAELKTGESGKVMSPKLPLGEYTVKETKAPAGYKLSDKEWKVTQNEKEVVKVEAENEKILGSLQIIKMDDKDQTKRLAGAEFT--KEGITTDKSGTVKVDGLVPGEYTLEETKAPEGYKALEVTIEVNVVANEVVKQDVLNE------KVKEEITGQLEITKVDADINKKLAGAVFEIWKDGTKI--DTLTSDENGKAISKELDPGDYILKEVQAPEGYELSDKEIEFTISNQKFEVVKLQITNKKETSKGPENPGEETEKPGEETEKPGEEKPGEETEKPGEETEKPGEETEKPGEETEKPGEETEKPGEETEKPGEETEKPGEETEKPPGEGMENPDKEKENPTLPEKGQGTSHAQQLPATGHDMNYLPFIGFALVLLGIRLRFMTKNN.. 969
25 -22.400IDP06516 von Willebrand factor, type A [Enterococcus faecium DO] EAN10603 [Enterococcus faecium DO]  ali follow..  213..IGGEKKIVFVLSMLLSRIGMVNFYHNSTAINNHEQISSDIFPLTNDINRLTGSENTALNRTPIGGTPLTLKNGYETLYKDNGGENRNPEKI-GDGTPTFSYAPIQSSYRTSTNGATHPVTYASDFNRPEDEVNVHYRYGEVKEGDNKATHWVGDGSSNNNTNGSPTSQEKSSAINTVAYHHWLKNKYQENPPSIFSIGLGIDGNVSGRQRLDGRNVLKNIADL----EEDGVTPRYYNANNKNDIVTALEDISSTFKRTIQQATLYDETGFNRSADIQFYHLDPGENGMKYQEPEIWDEERHGQAPPEVVATPTTYVGRENQAYKFSPISLGERIKYQVKLDAGAQD-RNFQVSKKGQNGEPLAGVEFALYDQNPESGEAEPIETVSDIFWIREIAGPPRYQLVYQFQIKKYAANEDEMLGHYELVDEYTSGSRVGGPEVQEPNIEGTEYDELYVKLEMRNEFKPIHMNINKLIEGSNMPINGAEFENGLEIGYPVAKGLSGVNEVEEEKGRLTFYSVDEDGKYVIVDGEKVIHPIGEPDSFVYKDSEE-EYKIIESQNPEGFKEPDENDTWILRLYDNAIGTIQLKQTGEENWQYLTYTTDEEDRLWVAFTAYNTFDYREIRVRKLD---HEGHTLDGAGFDIRKVGDSSLPGIGYFYSRAVGVEKYVDLNYDQPLHLSIGEYEVSESVAPNGYRLSDQVFQFALNEEGKFIIEDTVIEDETATLEDELAPIDLELLKIDSMNSRRLEGAEFSIEKQNSAGEYEAPDPNDSSLFNASDLLEGVYRIKEVKSPDSYRKLPGYFILEISYREEPDIENDRVVPGKEAGTLKVEISYYPN---------------------------------------------------------------EEAETPDLQQELEYELLETNRIRLQLSVGNDPENPLPATGGSGRLFYILLAAFFMALAGALFVRQSKKE 1342
26 -21.100IDP91924 pneumococcal histidine triad protein B [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007441 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  14  417.................EDLLATVKYYVEHPNERPHSDNGFGNASDHVQRNKNGQADTNQTEKPNEEKPQTEKPEEETPREEKPQSEKPESPKPTEEPEEESPEESEEPQVETEKVEEKLREAEDLLGKIQDPIIKSNAKETLTGLKNNLLFGTQDNNTIMAEAEK...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 565
27 -19.400IDP05596 putative lipoprotein [Bacillus anthracis str. Ames] BA_3366 [Bacillus anthracis str. Ames]  ali follow..  12  1MSK---KWFISLLLSLGLLAGCEEAAVKLEKKVEPKQEEVAKQEEKKDEAKPEEKPEEKQAEQEQNKQDEQKEKQEQKVEEKPKEEKPQAQLEVKKEEKQQEQPKEQPAVNKQPEQQKAQEEKQQQPKAQEVKEEAKVVNQPKETPKQEQKKKPEENNSVPTPPTPVPDPVPPVPDPVIPKPKQVTIS-KVLQRTGLDVDAMWKYRVNGATVKPGDTIE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 272
28 -19.300IDP05555 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo1413 [Listeria monocytogenes EGD-e]  ali follow..  15  285................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................VTVTYKDTKGNQLADPVIL--KGDI-------GSFETEAKSF-KGYKLTKTPSN-VFTSDSQEVEYVYSKDD-----------------------------------------------------------AVITPPVTPVNPDKPIINPVKPVNPATSTVPNKNISKKNTTKTVNQTGKTSTALQLPKTGDSENNLPLIIGVSLLISGVYIFTTRRKRV 438
29 -19.300IDP90415 gene: omcB; 60kDa Cysteine-Rich OMP [Chlamydia trachomatis D/UW-3/CX] CT_443 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  11  1.........................................................................................................................................................................................MRIGDPMNKLIRRAVTIFAVTSVASLFASGVLETSMAESLSTNVISL------DTKAKDNTSHKSKKARKNHSKETPVDRKEVAPVHESKATGPKQDSCFGRMYTVKVNDDRNVEITQAVPEYA------------------------TVGSPYPIEIATGKRDCVDVIITQQLPCEAEFVRSD------------PATTPTADGKLVWKIDRLGQGEKSKITVWVKPLK---EGCCFTAATVCACPEIRSVTKCGQP---------AICVKQEGPENACLRCPVVYKININQGTATARNVVVENPVPDGYAHSSGQRVL-----------------------------------------------TFTLGDMQPGEHRTITVEFCPLKRGRATNIATVSYCGGHKNTASVTTVINEPCVQVSIAGADWSYV-----CKPVEYVISVSNPGDLVLRDVVVEDTLSPGVTVLEAAGAQISCNKVV--------------TVKELNPGESLQYKVLVRAQ-----TPGQFTNNVVVKSSCAEATTYWKGVAATHMCVVDTCDPVCV-----------GENTVYRICVTNRGSAEDTNV-----SLMLK-FSKELQPETVEFSVTLKAVSAGDARGEAILSSDTLTVPVSDTENTH..................................................................................................................................... 551
30 -18.800IDP05657 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo0175 [Listeria monocytogenes EGD-e]  ali follow..  15  267..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ANITVNHLDSNGNKIAESDTTGVVNSYQSESKKITGYTLETTPTATGFTDTPQTVDYIYKKDTVTPT----------------------------------------------------------------------------PITVNPVEPVKPVNPVVNKPVTVKPANDNTNPSTSNSVEKTTYSSLPTTGDTDQSKSSTIFGALLLLISAPLLLFKKK. 415
31 -18.400IDP91533 gene: omcB; OmcB [Chlamydia muridarum Nigg] TC_0727 [Chlamydia muridarum str. Nigg]  ali follow..  11  121.............................................................................................................................................................................................................................................................................................................................................TVGSPYPIEIAIGKRDCVDVIITQQLPCEAEFVSSD------------PATTPTADGKLVWKIDRLGQGEKSKITVWVKPLK---EGCCFTAATVCACPEIRSVTKCGQP---------AICVKQEGPESACLRCPVTYRINVNQGTATARNVVVENPVPDGYAHASGQRVL-----------------------------------------------TYTLGDMQPGEQRTITVEFCPLKRGRVTNIATVSYCGGHKNTASVTTVINEPCVQVNIEGADWSYV-----CKPVEYVISVSNPGDLVLRDVVIEDTLSPGITVVE-------------AAGAQISCNKLVWTLKELNPGESLQYKVLVRAQ-----TPGQFTNNVVVKSSCAEATTYWKGVAATHMCVVDTCDPICV-----------GENTVYRICVTNRGSAEDTNV-----SLIL-KFSKELQPETVEFSVTLKAVSAGDARGEAILSSDTLTVPVSDTENTH..................................................................................................................................... 552
32 -18.200IDP05082 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo2179 [Listeria monocytogenes EGD-e]  ali follow..  10  4LKK---VSILICTLLIVSLL---------------------------------------------PFSVWADSQERDGTDVEEITTKEKVTQETTSNETTSEPLKGTTVNKAINAKSFPTGNY---------------------------------------------------------SGDFSINSQKDVIESGQTVNYNIYLKITGPNTRQNAKLVINLPKNGEFNQSLNELKIAGATKTTRQLVYTYQTLNSGVV---DKVILKMTTKNGYTPNGTKLVVTGELSADNLSEKVT---EQAETTVNATATTALSNDFTKVENSINNNPSQGDIGIWSFNLNIPKKSTKKIVIEYTLADKLDYLGVA---------GDTPEPTKVEGQKLTWEIAKANSLLNKTFQIRTFQPTIPNFATVENKAVATTNFVTLTDSIVDTSKASVDANWGIATVTGNPDIKVYDTAKLGFSLMLNSAMNDKGPFEAMVLLPSGVKMKNTEQNGFKVTVLNENYQNAGRQLDKKTLLPAEKLTAKINVSVAKD---TPSNMTVEMFGFLQDTDFNVPEVSGTPTISDTKMEIDSNDINQNGNSEESRITSGNHYILNTSNHLKISKKANATTNSIVSYQLSLENDSDEKIANMVLMDVLPS--------ENDLGITDNSERGSKFNLALTKAVE---VPKEWKDKVEVTYSTAKNPKRAGEPLVDNTEATQADWLTASEVKDWSNIYSFKIELKEGIEWIKIQFDLKTPKKNQIDKTLLKDQNHKQIASP-AYGEKFTAKQKKINNYSLVKIPANVSGTFNEKAQTITFIYQKVTAGRIIVNYVDKNGEKIADSIVLN--------------------------KLNSSYTTSSKKISGYKLYQTPKNATGKFLNTSQTVTYVYERTSNLSISSSNKGTENVKKLAKLPHTGDSTTTNLWVIIGLFMLSGAFVIMKKR... 1152
33 -18.200IDP91664 gene: BBC3; bcl-2-binding component 3 isoform 4 [Homo sapiens] NP_055232 [Homo sapiens]  ali follow..  32.........................PSAVSCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRP---DGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSP........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 167
34 -17.200IDP91949 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007099 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  13  838.................KTSEKVEKEKLSETGNSTSNSTLEEVPTVDPVQEKVAKFAESYGMKLENVLFNMDGTIEYLPSGEVIKKNMADFTGEAPQGNGENKPSENGKVSTGTVENQPTENKPADSLPEAPNEKPVKPENSTDNGMLNPEGNVGSDPMLDPALEEAPAVDPVQEKLEKFTASYGLGLDSVIFNMDGTIELR---------LPSGEVIKKNLSDLI.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1038
35 -17.000IDP91910 surface protein PspC, partial [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100003565 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  12  21.........................LEKPKPEVKPQLEKPKPEVKPQLEKPKPEDKPQLEKPKPEVKPQLEKPKPEVKPQLEKPKPEDKPQLEKPKPEVKPQLEKPKPEVKPQPEKPKPDNSKPQADDKKPSTTNNLSKDKQPSNQASTNEKATNKPKKSLPSTGSI..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 162
36 -16.900IDP06422 gene: H5R; H5R [Monkeypox virus Zaire-96-I-16] NP_536522 [Monkeypox virus Zaire-96-I-16]  ali follow..  1..............MAWSITNKADTSSFTKMAEIRARNSAENKDKNEDIFPEDVIIPSTKPKTKRTTTPRKPAATKRSTKKDKEKEEVEEVEEVVIEEYHQTTEENSPPPSSSPGVGDIVESVAAVELDDSDGDDEPMVQVEAGKVNHSARSDLSDLKVATDNIVKD..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 155
37 -16.900IDP01916 hypothetical protein lmo0327 [Listeria monocytogenes EGD-e] lmo0327 [Listeria monocytogenes EGD-e]  ali follow..  11  445...........TVNYVYKKYTLTSTYKDTNGQELKAPDATTYHYQDTYTTTAAVFPGYTLVATPTNATGTFGSSNNGYQLTSTFKDQQGKTISPDDVDTKTYHVNDPYTTTAKTIPGYTLVTTPTNNQGNFGTSDIKAEDYTLTSTYKDAQGKELKQPVVDSKKYHIQDNYSTSAATIPGYTLVATPANETGTFHTSDVTVNYVYKLTDLKLAQGTELK---PPVVDSKTYHIQDNYATTAAVIPGYTLVATPANQSGTFGSTDIQVNYVYQAVAYKLTSTYK-DQQGNDLALPKVDTKTYHIQDGYTTSDIAIPGYTLVAAPTNQTGTFGASDVTVNYVYKANDYTLTST---YKDA--QGKELKTPVIDTYTTTGATIPGYTLVAAPANQSGTFGAANVTVNYVYKADDYTLTSTYKDANGKELKVVDSKTYHTKDNYSTSAATIPGYTLVAAPANQTGTFNTSNVTVNYFYKKNVQGTELKPAIVKKGFIIKDGYSTSGVTIPGYTLVATPSNKKGT---------------------------GASNVTVNYVYKANGYALITTY----KDTQGKDLKPLAIDTKTYNINDPYTATALNIPGYTLTTTPANEKGVFGASDETVNYVYKANDYTLT----TTYKDANGKELQ-------------------------------------APKVDAKTYHIQDTYKTTAAVIPGYTLVAIPKNDQGTFGANNVTVNYVYQTNDYT-----LTATFKDAQGNELKATEVDAQKYHI-------HDTYTSKAAVIPGYTLEKTPTNETGTFNASDIQVNYVYKANDYQLTSTFKDQQGNE--------------ALPTVDAKTYHIHEAYTTKARLIPGYSLVAAPKNQIGAFGTSDVTVN--KKDAIIKPITPAKPTILTIKTPASKVIKTKVVKQTLPKTGDDDAGLLNLLRLIGLVLGVFLAVGSKKLR 1348
38 -16.600IDP91038 hypothetical protein SAHV_2481 [Staphylococcus aureus subsp. aureus Mu3] SAHV_2481 [Staphylococcus aureus subsp. aureus Mu3]  ali follow..  12  1MRDKKRKSILIGSLMYLG--------TQQEAEAAENNIENPTTLKDNVQSKEVKIEEVTNKDTAPQGVEAKSEVTSNKDTIEHEASVKAEDISKKEDTPKEVANVAEVQPKSSVTHNAEAPKVRKARSVDEGSFDITRDSKNVVESTPITIQGKEHFEGYGSVDIQKNPTDLGVSEVTRFNVGNESNGLIGALQLKNKIDFSKDFNFKVSNTTGADGWGFLF.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 246
39 -16.500IDP06012 membrane-attack complex / perforin domain-containing protein [Toxoplasma gondii ME49] EEB00555 [Toxoplasma gondii ME49]  ali follow..  1..............MLLS-AIGGIGPTESRLQHIPFSTTRYLPIRSHQSTVERIESPEALNEVPTKVERNEFTEKGDKTEQVLTAQADHKSLLEGRSVRLESTSTAPDDDFDFLFEDDTPKKPKSRVNKGTSSDETSPGDRSSGEGSSDSDSLLSVVHRTKGNATQANKNQTRITHPKSKAQHQKKVTKKQGIPGSD....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 184
40 -16.400IDP91682 gene: ORF73; nuclear antigen LANA [Murid herpesvirus 4] MuHV4gp74 [Murid herpesvirus 4]  ali follow..  10  1........................MPTSPPTTRNTTSGKTRSGCKRRCFNKPAAMPPKRRRAPKRPAPPPPPGCQGDEESSQGTQTPNPPSPPVPPSSPTLPSSPVPPSSPVHEPPSPSPPPAPPSPDVDVEGLDVGETDDPGPPPPKRYSRYQKPHNPSDPLP........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 140
41 -16.300IDP04017 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1035 [Clostridium perfringens ATCC 13124]  ali follow..  12  1MRK---VSLLLSIGILSGAFIGCGRNNQKEVSDNENSSNISNEEKNNKEVKNDNNDKKESKDSENDTKDNKDKNEQRDKEDLNKENMKEERDPKLDESVIVNNGIIIIPKNLKMAKIMLNYNDGDPLEVNEIKDYREVENNEMLYGVIIGDNPLKLGSING........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 159
42 -15.900IDP00754 gene: spa; immunoglobulin G binding protein A precursor SACOL0095 [Staphylococcus aureus subsp. aureus COL]  ali follow..  10  1MKKKNRKSVTLGTLLISGGV--TPAANAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQS.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 186
43 -15.500IDP05521 putative cell surface protein [Clostridium difficile 630] CD1858 [Peptoclostridium difficile 630]  ali follow..  14  1MKK-NKKAVVISLFAVFAQTLVNPIEAVAQIKVEVEIKAEKGRLLDSGDLPIIPDDMKFIDDFLFYEVKGDGKDEIIRKVTKIDVKDKETQTENESSKSEQSSQSNASKIENKGTQTELSKDDISKMEKESKELKEKLDKLNQEIKDKDKLSEKQKDKIKDLEEKIDKLKEKLEKGKDDKDLSADMKKEIDKLTD......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 235
44 -15.300IDP05070 putative surface protein [Clostridium difficile 630] CD3246 [Peptoclostridium difficile 630]  ali follow..  23  1..............MVFTIVSYADEVTSNDTILNGEEQSNGQTPDVEKPSDGQVPGGEKPSQVPDGEKPSDGQVPDQIPDGEKPSDGQIPDEKPSDGQIPDGEKPSQMPDGEKTSDSQTPDPSDGQMPDGEKPLDEQTPEEEKPLEEEIVIEEMSLKQDIDKILDMTLSQIN................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 177
45 -15.300IDP05386 hypothetical protein BA_2029 [Bacillus anthracis str. Ames] BA_2029 [Bacillus anthracis str. Ames]  ali follow..  1MKR--RIGTAVVGLSVLGFGIFGFTHGNGGGVVQAASEGDGGGAPAYAHGNHGGA---PTYTHGEGWSPSYAHGHTGGAPSYTHGHTGAPVYGYGDYPIPSFNVGDTPAPRLDADGDHGGAPTYTHGHFPAPKLESDGYTGGAPSYNKEDTWSPSYAHGNTGAPSNTEPGGGI............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 168
46 -15.200IDP05677 hypothetical protein lmo1068 [Listeria monocytogenes EGD-e] lmo1068 [Listeria monocytogenes EGD-e]  ali follow..  14  1MKKWMVIISIISLVALL-----GACGNNDNEKDQEDKSTTDSTTKKAKSSSNESNKAAETKENDTNDKAATTDKGSSNPTKEEKDTSTTTDTPKKETPKSPAKTEAFSFSPSGFKVSTVESILGGD.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 121
47 -15.100IDP05561 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo2026 [Listeria monocytogenes EGD-e]  ali follow..  11  334....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SNGDTLATPDILSGNEGDAYASTKTIDGYTLTQTPTNAQGTFTEVTVKYLNEEGKILTASDNL--TGNVQTKAKEFAGYTLDESKLPSGFKTNAQTVTYVYKTIPASIKAHDSTMNVGDTWSAKDNFDSAVDSLGVAVPFDEVKVDGSVDTTKAGVYPVTYSFAGDSVTIKVTVKATVVPAPPITPIKPVVPAPANPNTPSTQQTPTKQSGTLKIKATHQEQPIVAGNLKLPTTGDNLSVLYSIFGFITVCLSFVLFFRLKKQK 624
48 -15.000IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali follow..  1791.................RARLQAAQARLAAARETEVSSSETESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMSGVKAAYRRLEEENTRLAATRRRDDKLQRQVEAERERAVELLKEATRRAKEEKDLIARQPPPARDWSDTVVLSTPQIFVNSQAACAPFADSGRDEGGRDEWYEVSDACSRRAESSNESRTTAGAKLRQQQLDL-AGRT................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1990
49 -14.800IDP02382 hypothetical protein lmo0320 [Listeria monocytogenes EGD-e] lmo0320 [Listeria monocytogenes EGD-e]  ali follow..  13  139....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................DYIQTAINELFLNNNPTGTILTITDQNAINAVQINTVTSSEKESFQEQLNNAQ-QQLDARIAQEQAAIQAVNQLFLED-SIKAETTQDLIDQAQTLVD-VLPASELKDTLQANIVKAQTELDERSKPVTPPKNDPEPDNPEEPVTPVDPATPIPDEPSTPTDPATPEKPEITTPENPESTVVEADSSENEPEKSADSKIVNNPIQITSQATKTATKQAK--SSATKTTLPLPKAGDTETTSSILFGTLMLSSLVLFKRKK.... 399
50 -14.800IDP91997 cell wall surface anchor family protein, partial [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100004547 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  14IRRLS--SVVVASGFFVLVGQPSSVRADVVNPTPGQVLPEETSGTKEGDLSEKPGDTVLTQAKPEGVTGNTNSLPTPTERTEVSEETNSSSLDTLFEKDEEAQENPELTDALKETVDTADVDGTQASPAETTPEQVKGGVKENTKDSIDVPAAYLEKAEGKGPFTAG..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 182
51 -14.700IDP92694 TpgX protein [Staphylococcus aureus subsp. aureus ST398] YP_005735174 [Staphylococcus aureus subsp. aureus ST398]  ali follow..  1MKK---VTGLLALSLFLA-------ACGQDSDQQKDSNKEKDDKAKTEQQDKKTNDSSKDKKDNKDNSKDVNKDNKDNSANDNQQQSNSNATNNDQNQTNNNQSNSGQTTNNQKSSYVAPYYGQNAAPVARQIYPFNGNKSQALQQLPNFQTALNAANNEANKFGNGHKVYNDYSIEEH......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 170
52 -14.400IDP91727 gene: BCL2L11; bcl-2-like protein 11 isoform 1 [Homo sapiens] NP_619527 [Homo sapiens]  ali follow..  1..............MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS-PPCQAFNHYLSAMASMRQAEPADMRPEI........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 146
53 -14.300IDP00824 IgG-binding protein SBI SACOL2418 [Staphylococcus aureus subsp. aureus COL]  ali follow..  10  1MKNKYSKTITLATMISNQQTSTKHQTTQNNYVTDQQKAFYQVLHLKGITEEQRNQYIKTLREHPERAQEVFSESLKDSKNPDRRVAQQNAFYNVLKNDNLTEQEKNNYIAQIKENPDRSQQVWVESVQSSKAKERQNIENADKAIKDFQDNKAPHDKSAAYEAN........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 180
54 -14.100IDP91698 gene: NPM1; nucleophosmin isoform 1 [Homo sapiens] NP_002511 [Homo sapiens]  ali follow..  10  102LKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVE........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 265
55 -13.700IDP01843 gene: actA; actin-assembly inducing protein precursor [Listeria monocytogenes EGD-e] lmo0204 [Listeria monocytogenes EGD-e]  ali follow..  11  1MG--NR--FMRAMMVVF----ITIFAATDSEDSSLNTDEWEEEKTEEQPSEVNTGPRYETAREVSSRDIKELEKSNKVRNTNKADLIAMLKEKAEKGPNINNNNSEQTENAAINEEASGADRPAIQVERRHPGLPSDSAAEIKKRRKAIASSDSELESLTYPDKPTKVNKKKVAKES........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 180
56 -13.700IDP90291 high mobility group (HMG) box domain-containing protein [Toxoplasma gondii ME49] TGME49_081900 [Toxoplasma gondii ME49]  ali follow..  27LKQGAEAG---------GAVKLT---GNPSEQSSEDGSHHCSSNFQNSPVTSDLSVLDASPCGLPAEKRKPPHRETSISSNASQSEREIAPTATRRLSPKPETATLSPSESSSLTAATLSNCSSRVQSSSDEKIGNCPSTSACSVSQTTASSEAPSWLSSGASTAQVLSERRGSIEEQPAPETSAAAVRVSRSS.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 208
57 -13.700IDP02799 hypothetical protein GBAA4787 [Bacillus anthracis str. `Ames Ancestor`] GBAA4787 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  1MNR---KIIVAMFLMIFTFVSTLQPLAVQAATKLADTSDEESMMNQVSPGTLKVKDGKEKAGKLVATNVISEDKEKDTRVVEFDVEDVEKVLNAKVKVDIDFLNYHHEYDVRIAFDQNSITPIHVEQPNEKEDPANKPDPNEKPDPSQKPDQKPDPDQQPNSNTIKDGEYSIPFKVLKNQTDEESKMNTYMVNPGVLK-------------IENGKKAIVTLKSQTEKDGAFVDAKVVSENKEKDTRVVEFE------ADLSKKLNTKVFIEMASRNYKQTHDVQLLFEQDKLEQIKNEEKQPEVEKPEVEKPEVEKPEVEKPDENKKTDAETIKDGEYSINFKALKDQTDEISMMNTYPGLLKVKDGKKYVFEKNGSFVDANVISEDKKAVEVAVDDLSKKLNAKVKVDIDSMNYHHFYDIQDKGSIKPLDNQGGNDNQGGNNNQGGNNNHDDNKTIDPNALKDGEYSIGFKVKDKTEEISMMNTYTKNKVKDGKKYVSFTLTNSSITKFEFEKNGAFVDAK------------------VLGTNKEQDTRVVEVEVADLSKKLNAKVKVDIDSMNYHHFYDIQFAFDKGSIKSLGNQGGDTNQDGNGNQGGNDNQGGSNNQDDNNNQDGTNNLNENPTVDPKNLKDGQYD-----------------------------------------------------------------------------------AFKVLKDKTEEISMMNQ---RLTVKDGKKYIAMTLKNSEWITKFQTEKNGGFADAKVVSEDK---NTRVVEFEANDLFAKLNAKVK---------------------------------------------------------DPTKIGAVGTVKEEPKNEPKNPVITPKVDNVKTIATPDFNRNADGKKKNEATNNDAKKEKNSKTADTAQLGLYMV-LLLGSLALLVRKYRAGR. 884
58 -13.600IDP92613 RecName: Full=Serine-rich adhesin for platelets; AltName: Full=Staphylococcus aureus surface protein A; Flags: Precursor SAOUHSC_02990 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  11  1MSKRQK-----SLA---EMFKIMGLPFISHSLVSQDNQSISKKMTGYGLKTTAVIGGAFTVNMLHDQQAFAASDAPLTSELNTQSETVGNQNSTTIEASTSTADSTSVTKNSSSVQTSNSDTVSSEKSEKVTSTTNSTSNQQEKLTSTSESTSSKNTTSSSDTKSVASTSSTEQPINTSTNQSTASNNTSQSTTP......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 214
59 -13.500IDP04210 ZZZ_0017 [Escherichia coli O157:H7 str. EDL933]  ali follow..  11  1........MINNVSSLFPTV-QKITLNPVKISSPFSPSSSSISATTLFRAPNAHSASFHRQSTAESSLHQQLPNVRQRLIQHLAEHGIKPARSMAEHIPPAPNWPAPPPNEQSRPLPDVAQRLVQHLAEHGIQPARNMAEHIPPAPNWPAPPPPVQNEQSRPLP........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 175
60 -13.400IDP91577 gene: ECs4550; EspF protein [Escherichia coli O157:H7 str. Sakai] BAB37973 [Escherichia coli O157:H7 str. Sakai]  ali follow..  1MLNGISNA---------GRQLVGIASRVSSAGGTGFSVAPQAVRLTPVKVHSPFSPGSSNVNARTIFNVSSQVTSFTPSRPAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEA..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 162
61 -13.200IDP91750 SPG2_STRSG [Streptococcus sp. `group G`]  ali follow..  11  476.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................NDNGVDGVWTYDDATKTFTVTEMVTEVPGDAPTEPEKPEASIPLVPLTPATPIAK--DDAKKDDTKKEDAKKPEAKKEDAKKAETLPTTGEGSNPFFTAAALAVMAAGALAVASKRKED 593
62 -13.200IDP01324 tonB1 protein VCA0910 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  1MRE-NRYVIAGGLSLAFHALLLITTDEAQVFAMPAGNPTQSVSINMVSMPKVAPAQPEQTQTEQSKPESVKPTPVQEVVKTPPAKPKVKPHKPKPQTVKKPVPAEQVPSKSVAKPQPEKVERTAETAQKPAPTPNQQPSQPTAASQGITSQPILVDKPALVSAQVQPRYPRIARKRGIEGTVMY-------------EIWLDAQGNQIKQQLSSGDQSALEIPIRFK......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 246
63 -13.200IDP06506 gene: fms22; LPXTG family cell surface protein Fms22 [Enterococcus faecium DO] AFK59070 [Enterococcus faecium DO]  ali follow..  19  198.........................PGEEPDTETQPEPDNESKPEITPGEKPDVDPEEKPDVTPEPDDSGNQTVPETNPDTDETENPEKPEVAPEEKPDVTPEPDTDSGNQTVPETNPDTDNETENPEKPEVDPEEKPDVTPEPDTDARDQGIPEKINKKTIQEDGK..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 341
64 -13.100IDP91504 putative translocation protein in type III secretion [Vibrio parahaemolyticus RIMD 2210633] VP1670 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  10  1.....................MRIKPSTDTPSTQPHSPQSPMPIDDHAMLQSRFERALKENPDQTKPQPNETNNQAALEAKKPFTENYSERSLASLHSTGSNQRKTAEKSAFAQNNDVVTENINNESDTSSPIALNTQDKMPSDMDANMKPDIRIPTTGDKKLPMEPSNKREKNADEQDAFERLVEDHDDSKTE.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 173
65 -12.900IDP05727 conserved hypothetical protein [Bacillus anthracis str. Ames] BA_4605 [Bacillus anthracis str. Ames]  ali follow..  16  1MAGGSRGVLNIAIAIVLVAVAIVAYQLFVPDTKEQASSSDKKVSQQTTKENKSEKAKGKEETKKNEQEKTEAKKKEEEKLKAEEEQKKAEEEAKANEKVPAEKTQPKATDAYTKSSWKPVGTEQGATPAMTFKKGTADWNEMNQAISAAIDVPVEQ................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 167
66 -12.800IDP05002 hypothetical protein lmo0086 [Listeria monocytogenes EGD-e] lmo0086 [Listeria monocytogenes EGD-e]  ali follow..  10  1MKKNILVVIIVSVLAIIETEGFTYSPKGKVVDFSSEAKYNDTWINNTDKKEMKPINDKTIEELGGDDAYIEMENNHYHFDLKKEMLVSQTAKETDIDIRSIKVEIDDNAEKRSLKTAKETEKETTKDSTEKESEKQSNDASGQKSAQNNERSESKDDQTQDASGNNTNGSANNNTARSNGTGGSNSDTNGSQPGGTQN--------------KPNEGDVNKANEIIKKLNEAENTNTFQVPIVDVNLTVKGQVAAAKLKLTDSSKRLNSLEAILYDSKNNIVKKEKLNSTKANQNFTFNNLKYGETYQVVVQGSYKSASNKNQDTIFFRQTVEAKPVVLTPKVTERGEDYMKAELTAT-ELYGHIDKLVLKIKENNSNVITSQKVTVDASQLTVKFNSLSSD---EYIIEMEELIVDGKNVTDDGWYFISSTLKAKPTIEGLNLSYSTDKGEFVASPVNLVDRDESITSIRYVAYLEDD............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 593
67 -12.800IDP06510 WxL domain surface protein [Enterococcus faecium DO] AFK58238 [Enterococcus faecium DO]  ali follow..  14  5VKK-----LIASILFVFPLLMVT--SVFADVEKTNESTQSENQSFDKTTFSEESITSETTESQSEASTNKRQEENKTSETSEVAEQTSDSSEAALARAVSADGYSEAATTEE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 109
68 -12.700IDP91037 gene: sdrD; Ser-Asp rich fibrinogen-binding, bone sialoprotein-binding protein [Staphylococcus aureus subsp. aureus Mu3] SAHV_0560 [Staphylococcus aureus subsp. aureus Mu3]  ali follow..  12  1MNKTARKSILVGTTLIFGLGNQEAKAAESTNKELNEATTSASDNQSSDKVDMQQLNQENTKNDNQKEMVSSQGNETTSNGNKSIEKESVQSTTGNKVEVSTAKSDEQASPKSTNEDLNTKQTISNQEGLQPDLLENKSVVNVQPTNEENKKVDAKTESTTLNVKSDAIKSNAETLVDNNSNSNNENNADIILPKSTAPKSLNTRMRMAAIQVKSGDYFTIKYSDTVQVYGLNPEDIK-KHDTANNLITYTFTDYVDRFNSVKMGINYSIYMDADTVDVTDEFKNKMTYGSNQSVNLDFGDITSAYVVMVNTKFQYTNSESPTLVQMATLSSTGNKSVSTGNALGFTNNKIGNYVWEDTNKNGVQVGNVTVTVFDNNTNTKVGEAVTKEDGSYL--IPNLPNG---DYRVEFSNLPKGYEVTPSKQGNNEELDSNGLSSVITVN----------------------GKDNLSADLGIYKPKYNLGDYVWEDTNKNGIQ-------------------------QDEKGISGVTVTLKDENGNVLKTVTTDADGKYKFTDLDNGN-----YKVEFTTPEGYTPTTVTSGSDIEKDSNGLTTTGVINGADNMTLDSGFYKTPKYNLGNYVWEDTNKDTEKGISGVTVTLKNENGEVLQ-----------TTKTDKDGKYQFTGLENGTYKVEFETPSGYTPTQVGSGTDEGIDSNGTSTTGVIKDKDNDTIDSGFYKPTYNL--EDTNKNGVISGVTVTLKDENDKVL-KTVTTDENGKYQFTDLNNGTYKV-EFETPSGYTPTSV......................................................................................................................................................................... 977
69 -12.700IDP06531 gene: fms7; LPXTG family cell surface protein Fms7 [Enterococcus faecium DO] AFK59141 [Enterococcus faecium DO]  ali follow..  13  1MNSLRTKQVLKGALVILFAVSTSVPQWTVYGESISSESESREVETTETTDAGNETKSSTSQTETNTETTVETSVTSTDQETTATTDNQQTEEATATKMSNDESSSAKVSDKENGTENDDIGKGENFNGKEYLNYFGKQMTEILNGPTEDIKS.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 152
70 -12.600IDP00531 gene: ccmD; putative heme exporter protein D YPO2737 [Yersinia pestis CO92]  ali follow..  10  1MT--HSWAEFFAMFYVWLAVAATLLSLLGLLMHTLWQHKQLLADIHRRQAREQRIRQAQLNQTSMHQVPLHQAPLHQAPLQQAPQHIANLQEKR.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 99
71 -12.600IDP91749 Q9DUM3_HHV8 [Human herpesvirus 8]  ali follow..  894.........................PYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQPGENQGPGDSPQEMT.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1036
72 -12.500IDP91912 hypothetical protein SpneCM_07064 [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007064 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  17.........................................................................................................................................................................................................................................................................................................SIKFRYIGSNDSITSLKGYISGYNSGIPNEIFSANNENDLQ-EITDKILPLGVHHVTISDVLSKYVQLLDGNEQELNDNQVTIETKKNEQGLVEVTAKFNPLEDDAKYVLKFTVTSSQEAFDAIAGDKTLTSDDAEEADATK-----------------------YSNKGAKVAYSYGIGTSRTKIKDYS---------KPTFKPSDPLTVPVEIEWKGVDGKSNPSANRPPSVELNLNQKKDGSIKDSYRKVTSPVQTNSFTENTSFAKVAKGYDYELKAPDAPGYTVEVQKTGTKEKPSFKVIYRQLPSLTVKKILEGEQSPNKSFTINVTLSDKDGKPINGKF------------------------NTTVTNGKAQISLKNSQETALSYLPRDTHYKVE-EVENSRTGYHVTYEKQEGTLSEDVQTIVTNHRLPTLSVTKVTGAFANLLQSFKITINDAQNKPLNGTVDLKKDKTIKILDLPLNRYSIEEEASSRGYQVSYDKKEGTLDANKSATVTNNKN...................................................................................................................................................... 531
73 -12.400IDP05007 putative lipoprotein [Bacillus anthracis str. Ames] BA_3383 [Bacillus anthracis str. Ames]  ali follow..  10  1MKMKK------------VAIASITIGTMLTMAACSPSADKETDKKEQVTAQNEGEVKTTSTDETSKTTKDTDKETNTSSNEKTDKDAKNTKESSGTESNGKTSTQNENVKTKEKETTGKTNDQTTSGKTTDQSTSTNSDGKTTKDPKKSVAVKTSVKEVAALVDSLDKQLAANPKLET.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 166
74 -12.400IDP04197 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_2510 [Clostridium perfringens ATCC 13124]  ali follow..  12  1MKK-LLVPVLVIIIFALLFVGC----TNSSNSSSDSSVEIINSNQQNSNSNNNNSSNNDTKKSDSNNASHKDNKDNNVSNNKNTNKKLDNKAEKLLKDIKEKAVKGEIIDYDFKLGDSIYDVIDKLGKPSSENYVAE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 132
75 -12.300IDP05012 cell wall surface anchor family protein [Bacillus anthracis str. Ames] BA_5070 [Bacillus anthracis str. Ames]  ali follow..  10  1MKK-----------KLLPICAIALLTVGYSSVASADTGTVTKEEATQLQQDKAKKEAAIKEQQKIEEEKKRIAQEQLKNDMAKKEEAIKAQQKSEEGKKEAAQVQPKNAATKKEVAKPAVQGEKLPNTASN......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 120

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.