current user: public

If you have questions about the server, please let us know.

Query: IDP05162 hypothetical protein BA_1701 [Bacillus anthracis str. Ames] BA_1701 [Bacillus anthracis str. Ames], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MKGKNSKFLASVCVSSALMVSTVYPSVNAMAAEVAIVKTKAVTVDAITVANNEKEAEDTIKVTGLVTGDIVKVYDAASKGKELGTTKVAENATDATITGKDLLAVAGGTVYVSVQSKDQLESPRTAKKYDTQVSLAPAVKNIVILNNDDADDIVRVTGLESGDVVKVYGEATGGEVIEKATVQGNKTAVNVKIPQLGIEAGKVYVTVTKPNKDESKRVGKDYIAELast
1 -84.900IDP05162 hypothetical protein BA_1701 [Bacillus anthracis str. Ames] BA_1701 [Bacillus anthracis str. Ames]  ali  100  1MKGKNSKFLASVCVSSALMVSTVYPSVNAMAAEVAIVKTKAVTVDAITVANNEKEAEDTIKVTGLVTGDIVKVYDAASKGKELGTTKVAENATDATITGKDLLAVAGGTVYVSVQSKDQLESPRTAKKYDTQVSLAPAVKNIVILNNDDADDIVRVTGLESGDVVKVYGEATGGEVIEKATVQGNKTAVNVKIPQLGIEAGKVYVTVTKPNKDESKRVGKDYIAE 225
2 -11.400IDP05411 putative chitin binding protein [Bacillus anthracis str. Ames] BA_2793 [Bacillus anthracis str. Ames]  ali follow..  15  217......................................TEAPSIPNGIQAQKVTANSIELAWTASTDNVGVKGYQIFRNGEMIDTVPGT------HFIDKKLQPSTEYSYTVKAIDAAGNASKESAKLTVKTDTEAPTQPKLHSMGTTTSSVDLMWSPSDDNIGVGHYDIYRETEGSMKKIATSNTTSYMDK----PNTTYKYVVKAVDVAGNESVQSDI..... 397
3 -10.400IDP05125 putative lipoprotein [Bacillus anthracis str. Ames] BA_4310 [Bacillus anthracis str. Ames]  ali follow..  15.................LAGCNTNKEEPKKEQKLEAVKVAVQTNPKEIKPGEKTEVQALVTQGKVTDADDVKFEVWKAGDEKHEMLEGKHKGKGVYAVEKTFETDGVYHIIAHTNAREMHVMPEVKVAVGNAKVEDAKKENSDHGAGHGDHKSDTMGDIKANAESTIWKDGVEKHEFIPAKEGNKGEYETKHT---ENGSYKVKVHVKKGELHEHKEETVEVK.. 246
4 -10.100IDP05036 hypothetical protein BA_1663 [Bacillus anthracis str. Ames] BA_1663 [Bacillus anthracis str. Ames]  ali follow..  12  85..........................................................TVNKPELKVGEEVLVTIEPKEKNVQSIKGIETKRWIANYKVETFDLQGDWNLQVQSYKENEKEEIHINNEMPTLDKELPKLHKVTIDEMKGNVIER-----KQGDSIRVVKATDVESAVKEVHVKRDMDWVFEITDALPSGTYELLVEVVDAAGNKL.......... 289
5 -9.720IDP05700 hypothetical protein lmo2467 [Listeria monocytogenes EGD-e] lmo2467 [Listeria monocytogenes EGD-e]  ali follow..  11  241....................................................................................DGVVIGESQTASYEDTTVESNTAYTYTVRAKDFAGNKSTLSNSINVTTDNEAPTAPKLMSHGQTDTTIALCWQASTDNVEVKNYEIYRNNTKIATST-----KTMFEDTKLASNTSYNYKVYAVDTSGNRSLVSNE..... 378
6 -9.350IDP05615 putative lipoprotein [Bacillus anthracis str. Ames] BA_5522 [Bacillus anthracis str. Ames]  ali follow..  14  11............................................................................................................AATVLISGCNKEVVKESPKDKVEQHKKNTPLKIDEVKINTVNGKTLMVDVKAKGEKLTYYYIYKGEEIVEKIWYKPENSLKYEVKEP---GKYKVKAYAKDANKKIDSVYTNEVTIE 125
7 -9.000IDP04348 two component regulator [Clostridium perfringens ATCC 13124] CPF_2547 [Clostridium perfringens ATCC 13124]  ali follow..  12  462......IPNEKGNYQLDVRVKDKYSTKEYDVHTVLNFKVREYAEGKIDHIL-LVGDDIDIEVIVQNTRQVKVKYVTKVNGQVVEETDYVKNKR-------TPKCPGKYTIDIFARNIKCKEGFDSRREVRFYVSEALPITGTKISTSD--------KVFKINEEINFSTKCEGGS----SLVQKYSRKSYYSFRPYVPGKYKVLVLTKSYYKKCADYDTFEFKVE 686
8 -8.420IDP02418 fibronectin domain-containing lipoprotein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1279c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  207..................RIIAVSFNGIKSGSSQVVSSTSKALPPQVEHLSASTDGSSKIILTDAPTYEDFSYYKVYSTSSSFLPFSVLAKTDKNSYEDIVEGAGKSKYYKVTMVDKDGLESPMPKDGVEGKTLGNPLAPSIILAQSTSEGINLEWSDNDTRAVYEVRRYGGEQ----NAVFKGIKEKRLKDVKALPGVEYSYEVIAIDSAGLRSEPSSKVKAAQ 411
9 -8.020IDP05436 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo2085 [Listeria monocytogenes EGD-e]  ali follow..  12  339..................................................................SGAVYAIKDN--SQSEVAKITTNQNGTGTA----EGLPPGNYTATEVTAPLGYQKNTTPKKFTITYGDTNPVKLTFQNAEKTGSITIFKQDEANANAVFDVKSI--DGTTLKKVTTNSKGYALA---ENLQPGTYVITEVTAPPG--SANEIRVTIPFN 491
10 -7.380IDP06545 gene: fms18; LPXTG family cell surface protein Fms18 [Enterococcus faecium DO] AFK59452 [Enterococcus faecium DO]  ali follow..  237..TLKKSANTGTPVAYKMAGQQTLMAGAIDKPNTYTIKIDVETEGSLKIKKVDKETGNVV------PGTVFHLDFG--KTLPAKDVTTDKEG---IATLDEIPHGAKVTITEKSVPAP-TIKSGETISVTSKNTREKGQIILNKMGVETGTDLWNDKYSLAGNTFAIRKDSPTGEIVQEMTTDEKGHAETEIANALELGTYYVTETKASNG--TFKPVKVELNYV 460

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.