current user: public

If you have questions about the server, please let us know.

Query: IDP05262 gene: maa; maltose O-acetyltransferase [Clostridium difficile 630] CD0872 [Peptoclostridium difficile 630], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MTEKEKMLSGKGYYANDELLVKEREYCKKLTRLFNNTLEDEYEKREDILRQLFGSVGKQINVEQNIRCDYGYNIHVGENFFANYDCIFLDVCKIEIGDNVMLAPNVQIYTAYHPIDAQLRNSGIEYGSPVKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVTKDIPPNTVAVGNPCRVIKKIEELast
1 -94.100IDP05262 gene: maa; maltose O-acetyltransferase [Clostridium difficile 630] CD0872 [Peptoclostridium difficile 630]  ali  100  1MTEKEKMLSGKGYYANDELLVKEREYCKKLTRLFNNTLEDEYEKREDILRQLFGSVGKQINVEQNIRCDYGYNIHVGENFFANYDCIFLDVCKIEIGDNVMLAPNVQIYTAYHPIDAQLRNSGIEYGSPVKIGDNVWIGGGVIITPGITIGDNVVIGAGSVVTKDIPPNTVAVGNPCRVIKKIEE 185
2 -90.900IDP02453 gene: maA; maltose O-acetyltransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA3402 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  58  3.TEKDKMLAGEMYIADDEELVADRVEAKRLTRLYNEAVETGDERRFTLLNQLLGSSADKAQINPDFRCDYGYNIHVGKSFFANFNCVILDVCEVRIGDHCMFAPGVHIYTATHPLHPVERNSGKEYGKPVKIGNNVWVGGGAIINPGVSIGDNAVIASGAVVTKDVPNNVVVGGNPAKVIKTIEE 187
3 -90.000IDP01515 hexapeptide-repeat containing-acetyltransferase VCA0836 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  34  3MSELEKMLKGEHFDGASAEIEALRSQAGRLKLEINQS--LDEAERYALQRELFGHLGHKSCVQPPFHCEFGKTIRIGDHTFINMNVVMLDGAPITIGDHVLIGPSTQFYTASHSLDYRRRQAWETICKPIVIEDDVWIGGNVVINQGVTIGARSVVAANSVVNQDVPPDTLVGGTPARILRSLKD 185
4 -88.600IDP04551 gene: maa; maltose transacetylase [Clostridium perfringens ATCC 13124] CPF_2912 [Clostridium perfringens ATCC 13124]  ali follow..  52  3MTEKEKMILGLPYNPADPELTKGRIRARILFQKFNKLDLPDNKERSSILKELLGSTGESIYMEPNFKCDYGYNISVGNNFYANFDCVMLDVCKITIGENCFFAPGVHIYTATHPIDPIERL-NYEFGKPVTIGNNVWIGGHATINPGVTIGNNVVVASGAVVTKDVPDNVVVGGNPAKIIKKVCA 194
5 -88.400IDP00698 galactoside O-acetyltransferase SACOL2570 [Staphylococcus aureus subsp. aureus COL]  ali follow..  46  1MTEKEKMLAEKWYDAFDQYLINERARAKDICFELNHTRPSATNKRKELIDQLFQTTTDNVSISIPFDTDYGWNVKLGKNVYVNTNCYFMDGGQITIGDNVFIGPNCGFYTATHPLNFHHRNEGFEKAGPIHIGSNTWFGGHVAVLPGVTIGEGSVIGAGSVVTKDIPPHSLAVGNPCKVVRKIDN 186
6 -85.500IDP04303 gene: lacA; galactoside O-acetyltransferase [Clostridium perfringens ATCC 13124] CPF_0251 [Clostridium perfringens ATCC 13124]  ali follow..  45  4KEIRERMYGQKLYYCNDEDLMREQMKALELLYDFNKTRPSEQDKREKILKKMFAEIGDDCYIEPPFHANWGKNVHFGNGVYANFNLTMVDDCDIFVGNNVMFGPNVTVSAGTHPIHPELRSKQAQYNIPIHIGNNVWIGANSVILPGVNIGDNSVIGAGSIVTKDIPSNVVAVGNPCRVLREINE 189
7 -68.600IDP01020 gene: wcaF; putative colanic acid biosynthesis acetyltransferase WcaF STM2110 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  23  1MQDLSGFTVPKGFRGANALKVQLWWAVQATL--FAGSPQILYRWRAFLLRLFGAKIGKNVVIRPSVKITYPWKLTVGDYAWVGDDAVLYTLGEINIGAHAVISQKGYLCTGSHDYTSAHFD---INAAPIVIGEKCWLATDVFVAPGVTIGHGTVVGARSSVFKSLPANAICRGNPAVVTRQRVQ 180
8 -56.400IDP00661 acetyltransferase, putative SACOL0827 [Staphylococcus aureus subsp. aureus COL]  ali follow..  31  2................RKFLSKTHHHTNPLWRVYRLVKFS--KVFKNVIIIEFSKFIPSMVLKRHIYKQLL-NINIGNQSSIAYKVMLFYPELITIGSNSVIGYNVTILTHEALVDEFRY-------GPVTIGSNTLIGANATILPGITIGDNVKVAAGTVVSKDIPDNGFAYGNPMYIKMI... 159
9 -50.800IDP02750 transferase hexapeptide domain-containing protein [Bacillus anthracis str. `Ames Ancestor`] GBAA5389 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  21  2.......................RRTTRYPVSGESSLWNVYKTVSKVMKNFIIIQIARPFLSVKNWLYRTFLRMKVGKKTSFALMVMPMFPEKITVGDNSIIGYNTTLLAHEYLIREYRL-------GEIVIGNEVMIGANTTILPGVRIGDGAIVSAGTLVHKDVPSGAFVGGNPMRVIYTKEQ 162
10 -45.000IDP02428 O-acetyltransferase, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA3580 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  26  7............................................QEELKKIGFLSVGKNVLISKKASIYNPGVISVGNNVRIDDFCIL-GEVGIEMYDFANISSRTIVYAAIDDFSGNANQYKNVKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVKESLDDWYIYVGVPVRKIKARKR 173
11 -43.800IDP01368 transferase, hexapeptide repeat family VC0238 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  31  48.......................................................IHNGANLKGVSIELNGNNLEIGENCVIGENCFLSSGTKLVIGKECMFSRNVKLMTSDHDILRDGKR--INPAKSIYIGSHVWLADNVTILKGVDIGSGSIIGINSTVTKSIGQYCIAAGNPARKIKD... 178
12 -40.700IDP01143 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase, putative BA_4194 [Bacillus anthracis str. Ames]  ali follow..  31  105......................................................EIGDNAVIMMNATINIG--AVIGEGSMIDMNAVL--GGRATVGKNCHVGAGAVLAGVIEPPS----------AKPVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARVIKEIDE 221
13 -39.400IDP06500 hypothetical protein spr0965 [Streptococcus pneumoniae R6] NP_358559 [Streptococcus pneumoniae R6]  ali follow..  20  111.......................................................CNEAVRIGEGGWNQKSANIKIGDYQFIGPRAQINVSDSVELMGYGGLGIETMIFTHGAGHGQSATDGFYAEQNKVIIQKNVSILTRAIILPGVIVSQGTTVAANAIVTKSFPKHSLIGGVPARYIGQSNK 240
14 -38.100IDP00651 gene: cap5H; capsular polysaccharide biosynthesis protein Cap5H SACOL0143 [Staphylococcus aureus subsp. aureus COL]  ali follow..  35  49........................................................................NSHIGEYSYIGFGSDFNN---VEVGRYCSISSDVKIGLGKHPTHKQKFIDFNDQPSRTTIKNDVWIGANVIIMDGLTINTGAVIAAGSVVTKNVGAYEVVGGVPAKVIK.... 171
15 -38.000IDP00054 acetyltransferase, CYSE/LACA/LPXA/NODL family BA_3600 [Bacillus anthracis str. Ames]  ali follow..  29  12........................................................................KYDIGDYTYSKVGPTIFDETKLKIGKFCSLGEEVVFLLGEHRADGAHITGHPSSKGDIVVGNDVWIGYQSCISSGVTIGNGAIIGARSVITKDVPPYAIVAGNPAKFVR.... 137
16 -37.500IDP05257 putative transferase [Clostridium difficile 630] CD2748 [Peptoclostridium difficile 630]  ali follow..  26  5................................................YLEDKPLIDESVFVAK--SADVIGNVKIGKDSSIWYNAVVRDEGPITIGENTNIQDCSIVHGDTETIIGNNVTVGRSIVHGCKISDNVLIGMGSIILDNAEIGEYTLIGAGTLITKKFPPGVLIMGSPGKVVRELTE 143
17 -35.600IDP93935 chloramphenicol acetyltransferase [Yersinia enterocolitica subsp. enterocolitica WA-314] EKA27919 [Yersinia enterocolitica subsp. enterocolitica WA-314]  ali follow..  33  34........................................................................NIIIGDYTYYDDPQDSENFEKLIIGKFCALAHGVKFIMANHKMSVAPSRDELPYKGDTHVGNDVWIGYDVLIMPGVTIGNGAIISSRSVVTRDVPAYSVVGGNPATLIK.... 172
18 -35.600IDP00043 acetyltransferase, CYSE/LACA/LPXA/NODL family BA_2629 [Bacillus anthracis str. Ames]  ali follow..  35  28........................................................................NILVGDYSYYDAKDGETFEDRLIIGKFCCIASGVTFIMANHRMDYTPNLSDLPYKGDTVIGNDVWIGMDATIMPGIKIGDGAIIAAKSVVTRDVAPYTIVGGNPANKIR.... 165
19 -35.200IDP01349 antibiotic acetyltransferase VCA0253 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  27  53......................................................................GFEASVVRYLHGDEISQRWDIDQLVIGDYVCIGAEVVILMGGNHTHRADIEQAYVGKGNTEIGDGAWLGMRAMIMPGVKIGEGAIVAANSVVTKDVAPYSIVAGSPAQLVK.... 177
20 -34.700IDP01350 chloramphenicol acetyltransferase VCA0300 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  31  21........................................................................NIIVGKHSYYSGYYHGHSFDKLVIGSFCSIGSGAVFMMQGHRSDFADARDGFTRSGDTIIGHDVWIGTEAMIMPGVKIGHGAIIASRSVVTKDVAPYEVVGSNPAKHIK.... 160
21 -34.400IDP92709 gene: satA; streptogramin A acetyltransferase [Enterococcus faecium] AAA24783 [Enterococcus faecium]  ali follow..  33  29........................................................................NVEVGEYSYYDSKNGETFDDKLKIGKFCSIGPGVTIIMNGANEKHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIK.... 165
22 -34.100IDP91546 gene: vat; acetyltransferase [Staphylococcus aureus] AAA26683 [Staphylococcus aureus]  ali follow..  30  34........................................................................NILVGEYSYYDSKRGESFEDKLIIGRFCSIGPGTTFIMNGANEKYMPSLKDLPLKGDIEIGNDVWIGRDVTIMPGVKIGDGAIIAAEAVVTKNVAPYSIVGGNPLKFIR.... 170
23 -31.700IDP00571 gene: dapD; 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase YPO1041 [Yersinia pestis CO92]  ali follow..  17  117.......................................................IARNTVLMPSY---VNIGAFVDEGTMVDTWATV--GSCAQIGKNVHLSGGVGIGGVLEPLQ----------ANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEVHYGRVP... 228
24 -31.200IDP01785 gene: dapD; 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase [Coxiella burnetii RSA 493] CBU_0667 [Coxiella burnetii RSA 493]  ali follow..  17  113.....................................................AYLAPNTVLMPSY---INIGAYVDSGTLIDTWATVGSC--AQIGKNVHLSGGAGIGGVLEPLQ----------AHPTIIEDDCFIGARSEIVEGVMVEKGSVISMGVFVGQSTPIYNRQTQEITYGRIP... 226
25 -29.600IDP00898 gene: wcaB; putative colanic acid biosynthesis acetyltransferase WcaB STM2114 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  30  56.................................................................FGYEIQAAATIGRRFTIHHGYAVVINKHVVAGDDFTIRHGVTI------------NRGADSLACPVIGNGVELGANVILLGDITIGNHVTIGAGSVVLDSIPDHALVVGEKARVKVS... 161
26 -26.500IDP01056 gene: yrdA; putative ferripyochelin-binding protein STM3399 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  20  8................................................YKNLFPGIGQRVMIDTSSVV----DVRLADDVGIWPLVVI-DVNYVAIGARTNIQDGSVLHVTHKSIGEDVTVGHKVMLHGCTIGNRVLVGMGSIVLDGAIIEDDVMIGAGSLVPKRLESGYLYLGSPVKQIRPLSD 155
27 -26.400IDP02535 gene: cysE; serine O-acetyltransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA0088 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  31  67......................................................EIHPGATIGRRFFIDHGMGVVIGETCEIGDN--------VTIYQGVTLGGTGKEKGKRHP----------------TIQDNVLIATGAKVLGSITVGENSKIGAGSVVLKEVPAHSTVVGIPGRVVIQ... 170
28 -26.100IDP90794 gene: cysE; serine acetyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0763c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  28  68...................................................................VDLHPGAELGRRIFIDHA------NGVVIGQTAIIEDDVLIY---QGVTLGGTSLEKGTKRHPTIKKGVIIGSGAKVLGNITIGENAKIGSNAVVVKDIGANLTAVGIPAYIIEERKN 176
29 -25.300IDP00538 gene: cysE; serine acetyltransferase YPO0070 [Yersinia pestis CO92]  ali follow..  32  143......................................................DIHPAATIGCGIMLDHATGIVIGETAVVENDVSIL--------QSVTLGGTGKTSGDRHP----------------KIREGVMIGAGAKILGNIEVGRGAKIGAGSVVLQSVPAHTTAAGVPARIVGKPES 249
30 -25.100IDP01343 gene: cysE; serine acetyltransferase VC2649 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  30  143......................................................DIHPAARIGRGIMLDHATGIVIGETAVVEDDVSIL--------QDVTLGGTGKECGDRHP----------------KIREGVMIGAGAKILGNIEVGEGAKIGSGSVVLQAVPPHTTVAGVPARIVGR... 246
31 -17.200IDP01449 UDP-N-acetylglucosamine acyltransferase VC2248 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  23  83........................................................................QLIIGDRNTIRESVTM-DKGITIVGSDNLFMINAHVAHDCVIGDRCIFANNATLAGHVKVGNQAIVGGMSAIHQFCHIGDHCMLGGGSIVVQDVPPYVMAQGNHCAP...... 194
32 -17.200IDP01019 gene: lpxA; UDP-N-acetylglucosamine acyltransferase STM0228 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  20  83..................................................................RVEIGDRNRIRESVTIHRG-TVQGGGLTKVGSDNLLMINAHVAHDCTVGNRCILANNATLAGHVSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHATP...... 194
33 -17.200IDP90556 gene: lpxA; UDP-N-acetylglucosamine acyltransferase YPO1056 [Yersinia pestis CO92]  ali follow..  23  83..................................................................RVEVGDRNRIRESVTIHRG-TTQGGGVTKVGCDNLLMVNTHVAHDCVIGNRCILANNAALGGHVEIDDYAIIGGMTAIHQFCVIGAHVMVGGCSGITQDVPPFVIAQGNHATP...... 194
34 -16.700IDP01633 gene: lpxA; UDP-N-acetylglucosamine acyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT1569c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  17  78..................................................................QVVIGDNNIIRECATIHGG-TAKEIGVTSVGNNNIIMCYVHIGHDCKMGSYINLVNGVGLAGHVHIDDYAILSSNVGVHQFCRVGKHAFIAHAALVGKDVPPYLMVTAVNAG....... 188
35 -16.600IDP90748 gene: lpxA; UDP-N-acetylglucosamine acyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0274 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  20  80........................................................................GVVIGKNATIREFATI-GDGFTRIGDNAFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIVPFCLAEGNRASI...... 191
36 -13.200IDP90723 gene: glmU; UDP-N-acetylglucosamine pyrophosphorylase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0821 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  16  220.................................INDKFELSIAENFMQKKIKKYWMQQGVIFHLPQSTFIGADVEFVGECEVYENVRIEGKSKISIVENSDVGPLAHLVKAGHLSYLGDCEIDSGTNHKTIIGKNVFVGSDTQFIAPVKIEDEVIIAAGSTVSINVEKGALFINRAGHKMIK... 420
37 -13.100IDP90716 gene: lpxD; UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0576 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  19  138......................................................SIGDESIIHPNVVI---NDTKIGKKCHLLANCVI-HNGNVVLEDFVEVGACTTIVQIGHNCNIGQNCAQTGISGSSELGRNVIMGGQSATSGHLKIGDFSTIAARGGVSKNLEGGRVYGGFPIMLQKD... 303
38 -12.900IDP00427 gene: glmU; bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase YPO4119 [Yersinia pestis CO92]  ali follow..  18  302......................................................VIGDDSEISPYTVLELDANCTVGPFARLRPGAELAEGAHVYLGD-AEIGAGVNIGAGTITCNYDGANK-----FKTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVTRDVAENELVISRVKQVHIQ... 447
39 -12.900IDP00318 gene: glmU; UDP-N-acetylglucosamine pyrophosphorylase CBU_1947 [Coxiella burnetii RSA 493]  ali follow..  30  351........................................................................KTTLGRGSKANHLTYLGDT---IIGKNVNVGAG----TITCNYDGANKWQ-------TKIEDGAFIGSNVALVAPLTVGKNATIGAGSTLSQDAPPDQLTVARERQRTIK... 446
40 -12.900IDP01179 Bifunctional protein glmU [Includes: UDP-N-acetylglucosamine pyrophosphorylase (N-acetylglucosamine-1-phosphate uridyltransferase); Glucosamine-1-phosphate N-acetyltransferase ] BA_0048 [Bacillus anthracis str. Ames]  ali follow..  22  352........................................................................KTVFGNRSKASHLSYIGDA---QVGEDVNLGCG----SITVNYDGKNKFK-------TVIGNGVFIGCNSNLVAPVTVEDGAYVAAGSTITENVPSKALSVARARQVNKE... 447
41 -12.800IDP02698 gene: glmU; UDP-N-acetylglucosamine pyrophosphorylase/glucosamine-1-phosphate N-acetyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT0387 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  20  299......................................................IIEDNVRIKSNSMVDIREGAIVGPFARVRPECDVKEGAVIYLGD-SEIGANCNIGAGVITCNYDGVNK-----HKTVIGDYAFIGSDSQLIAPVNIGQGATVGAGSTIVKDVPADNLAISRARQRHID... 444
42 -12.800IDP05540 gene: glmU; bifunctional protein [Clostridium difficile 630] CD3515 [Peptoclostridium difficile 630]  ali follow..  21  350........................................................................NAIIEDGSKASHLSYIGDA---HVGKNVNIGCGV--VFVNYDGKNKFK---------SIVKDNAFIGSNSNLVAPVVVEEKGYIATGSTITHDVPDGALAIARERQVIKE... 445
43 -12.700IDP01477 gene: glmU; bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase VC2762 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  299......................................................EIDDNTVIRPYSVIEVGENCTVGPFTRLRPGAELRDDAHVYLGD-AEIGKGVNVGAGVITCNYDGANK-----HKTVIGDDVFVGSDCQLVAPVTIGNGATIGAGTTLTKNVAEGELVITRAPERKIA... 444
44 -12.700IDP00656 gene: glmU; UDP-N-acetylglucosamine pyrophosphorylase SACOL0543 [Staphylococcus aureus subsp. aureus COL]  ali follow..  22  351........................................................................KADLKDGAKVSHLSYIGDA---VIGERTNIGCG----TITVNYDGENKFK-------TIVGKDSFVGCNVNLVAPVTIGDDVLVAAGSTITDDVPNDSLAVARARQTTKE... 446
45 -12.600IDP01928 gene: lpxD1; UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT0286c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  21  152......................................................KVGTNCIIWPSVII---DRTIIGHFCRLCSNCSI-HIGNVVIGSFVDIGSNTCIVQIGHNVIIGKGCGQAGISGSVTIGDGVIIAGNAGIKDHTNIGSDARIGGKAGVMWDVPAGESHMGYPAYKDSE... 318
46 -12.300IDP00356 gene: gcaD; hypothetical protein lmo0198 lmo0198 [Listeria monocytogenes EGD-e]  ali follow..  28  352........................................................................KAVVGEGTKLPHFIYMGDA---EIGKNVNVGCG----SIAVNYDGKNKAK-------TIIGDNVFVGCNSNLIAPVKVGDRAFIAAGSTITKDVPEDALGIARAKQDNKL... 447
47 -11.400IDP06172 gene: lpxD; UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Helicobacter pylori J99] NP_222903 [Helicobacter pylori J99]  ali follow..  25  140......................................................KIGKNCILYPRVIL---QNTILEDNVIIHAGSVI-HVGIVRIQKNVEIGANTAIVQIGHNCVLGEHSSQVGLSGSTTTGRNVVFGGQVGIGGHLHVGEFTQIGGKSAVGKDLPPNTNFAGAPAMEIHE... 306
48 -11.200IDP90874 gene: lpxD; UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Yersinia pestis CO92] YPO1054 [Yersinia pestis CO92]  ali follow..  21  147......................................................HIGAGSRLWANVSI---HEVVIGQNCLIQSGTVI-QLGSVHIGDRVEIGACTTICQIAHNVVIGDNTGGVIMAGSLKVGRYCMIGGASVINGHMEICDKVTITGMGMVMRPITPGLYSSGIPLQPNKM... 312
49 -11.100IDP00134 gene: VC2250; Vibrio cholerae O1 biovar eltor str. N16961 chromosome I, complete sequence VC_2250 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  20  147......................................................RLGDNTKLWANVTI---HKVEIGSDCLIQSGTVI-QLGSVRIGDRVEIGACTTILQIAHNVHIGYGSGGTVIAGSTRIGKYCIIGGASVINGHIEIADGVTITGMGMVMRSIEKGMYSSGIPLQTNKE... 312
50 -11.000IDP01632 gene: lpxD; UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT1571c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  20  145......................................................KIGNDTLIKSNVSI---HDVVIGTGCIIHQNAVI-QLGRVIIEDDVEIGSGTTVVQIAHNVVIGRNTGVTAVAGSTTIGDNCLIGGQSAITGHISICDNTIIGGASNIGKSITPGMYYAAFEAKPRIQ... 311

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.