current user: public

If you have questions about the server, please let us know.

Query: IDP05267 hypothetical protein lmo0255 [Listeria monocytogenes EGD-e] lmo0255 [Listeria monocytogenes EGD-e], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MKKFLSILSILVLALLVTACGSDSSDKKSAKKEEKMETVTYIADINGAKLEATFSHVGDNLRKVDQKMVYPLTALGLESGANLDDATKKQLEEQVASQYSAYKESKGASLETKFTDEALELTMSVDLYKADKDSVASLLGGTTDPKNVSLKETVKQFEAQGFKKKESLast
1 -84.000IDP05267 hypothetical protein lmo0255 [Listeria monocytogenes EGD-e] lmo0255 [Listeria monocytogenes EGD-e]  ali  100  1MKKFLSILSILVLALLVTACGSDSSDKKSAKKEEKMETVTYIADINGAKLEATFSHVGDNLRKVDQKMVYPLTALGLESGANLDDATKKQLEEQVASQYSAYKESKGASLETKFTDEALELTMSVDLYKADKDSVASLLGGTTDPKNVSLKETVKQFEAQGFKKKES 167
2 -61.400IDP05658 hypothetical protein lmo0207 [Listeria monocytogenes EGD-e] lmo0207 [Listeria monocytogenes EGD-e]  ali follow..  25  4LKKGTAVLFVMIMAVMLVACGD------------KEETKTYTLSQNGVDSKLTYTYKGDKVTKQTAENTMSYASLGVAS--------KEDAEKMLKATSDKFQGIDGLKEKIEYKDDKAIETLEVDYTKISSEDMNKIPGMSDTSKGISMEESAKMLESQGYKEVSK 153
3 -23.600IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames]  ali follow..  23  2LKKLGILVLGSAVALSLVACGDSTKEASNEKKEEPKQEAKKENKENKESKK.................................................................................................................... 52
4 -21.600IDP05677 hypothetical protein lmo1068 [Listeria monocytogenes EGD-e] lmo1068 [Listeria monocytogenes EGD-e]  ali follow..  20  1MKKWMVIISIISLVALLGACGNNDNEKDQEDKSTTDSTTKKAKSSSNESNKAAETKENDTNDKAATTDKGSSNPTKEEKDTSTTTDTPKKETPKSPAKTEAFSF............................................................... 104
5 -20.500IDP05009 putative lipoprotein [Bacillus anthracis str. Ames] BA_4237 [Bacillus anthracis str. Ames]  ali follow..  22  1MKAWKSIFVLCSFLLMLSGCFHQEEKKVEPKKKESIPETKEYGGRELKKV..................................................................................................................... 50
6 -20.000IDP04197 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_2510 [Clostridium perfringens ATCC 13124]  ali follow..  14  1MKKLVPVLVIIIFALLFVGCTNSSNSSSDSSVEIINSNQQNSNSNNNNSSNND-TKKSDSNNASHKDNKDNNVSNNKNTNKKLDNKAEKLLKDIKEKAVK--GEIIDYDFKLGDSIYDVIDKLNLSFGCNKGDQIFEIRSLNKDLKSLDLNNVENFF---G...... 178
7 -19.700IDP05460 putative lipoprotein [Bacillus anthracis str. Ames] BA_0985 [Bacillus anthracis str. Ames]  ali follow..  16  1MKKIISICALTALSFTLIGCASTSATDKSPQAKQEHKQNAFQLNSANITDIEILQTTNNTTSKSQTDNKEMIQSI............................................................................................ 75
8 -19.500IDP05625 putative lipoprotein [Clostridium difficile 630] CD1348 [Peptoclostridium difficile 630]  ali follow..  11  1MNKIAVSFLIIATTLLSTACMDYSISAVELVDSKESAVVKKDEDAKEESKKTTKIPIEIISKDEKIVKYLQIDE---------ESSLKDKLRLILDTLSNEY---NGLDMEVEVKEKDNLVKINLIEPDKKSRVSWKDDYLNEQNIIYTINNIIKNVIQEEDN.... 159
9 -18.800IDP05148 putative lipoprotein [Bacillus anthracis str. Ames] BA_0177 [Bacillus anthracis str. Ames]  ali follow..  14  1MKKIIFVSSLVLAISLGVGCSNEKTAKTDEPKKESVQKEK--------------ELTAKDVFKKTNEAFKNEEHVTMTYGVGVKAEGTEMDI........................................................................... 78
10 -18.500IDP05588 putative lipoprotein [Bacillus anthracis str. Ames] BA_2883 [Bacillus anthracis str. Ames]  ali follow..  12  1MKKIALLCLTFTCIFALAACKGTDEKKETNPTSENSKNEQNTSSEGKKEPEVKSNTDSNSKDIVINQKSINHVKNLFELAKEGKVPNVP---AAHTGDIEEIEKAWGKADKTEQAGNGMYATFTVSFGFNKGSQVFDVRSYHAELKSITLQEIEKAL---G...... 162
11 -18.400IDP02672 hypothetical protein FTT1602 [Francisella tularensis subsp. tularensis SCHU S4] FTT1602 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  14  1MKKQLFAISITTALLVLSACGQTGPLYLPDEDKLNSGSTLAKSGSSIMVKQNQQNNSTSTSDNQSDTST.................................................................................................. 69
12 -18.300IDP05763 hypothetical protein lmo2331 [Listeria monocytogenes EGD-e] lmo2331 [Listeria monocytogenes EGD-e]  ali follow..  19  1MKKALLAGFMLAFSIFLTGCGGTDNTRKENHSDGSAEVKNKKDNNTSDEYV.................................................................................................................... 53
13 -18.200IDP05670 hypothetical protein lmo0617 [Listeria monocytogenes EGD-e] lmo0617 [Listeria monocytogenes EGD-e]  ali follow..  24  4LKSILLLMGIITFALALTACGGTEDKASTEKIETAKAETKKKSNP.......................................................................................................................... 48
14 -18.000IDP05010 putative lipoprotein [Bacillus anthracis str. Ames] BA_4934 [Bacillus anthracis str. Ames]  ali follow..  13  1MKKVLLFVLLLTASILLIGCSTKKEKAGM-NLEKAQKVEIESLTDSSEKKVITDKKEIEKLFEVMKMDKWEMQSAPLDTPQGKTFKMYQEDTTKLSESSKDKKELHEIGTMTVYKDVPYVKKMSFKVPEDVAKDLLKY............................. 144
15 -17.900IDP04392 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1500 [Clostridium perfringens ATCC 13124]  ali follow..  20  1MRVLKGVILAIIPAFLFMGCGEFSKNDVAKVSFEKLSEKE............................................................................................................................... 40
16 -17.700IDP05121 conserved hypothetical protein [Bacillus anthracis str. Ames] BA_0915 [Bacillus anthracis str. Ames]  ali follow..  16  2LKKFTTCILGGALVFNLSGCGNTSDKTSSESKETNSKQEEKNVQTTDEAKTKENTKQKNT........................................................................................................... 61
17 -17.400IDP05592 putative lipoprotein [Bacillus anthracis str. Ames] BA_3194 [Bacillus anthracis str. Ames]  ali follow..  22  1MKILKFGIIGALSITLLIGCTSNSNETKASNKEASTAVKE............................................................................................................................... 40
18 -17.300IDP05564 hypothetical protein lmo2431 [Listeria monocytogenes EGD-e] lmo2431 [Listeria monocytogenes EGD-e]  ali follow..  14  1MKKITILMLSITAALLLASCGNDTTTDMNNETTKTENKSQAALTTDMAGRDVSFDKKPERIIALTNADMNIIYALGGTVVGRQTTDASG-----VPDGAKKATEVGNTHD-----NLEKIASLGADAIVASVPAMEGVGPKVVLTGANSIDEIKKQTAVLG...... 160
19 -17.300IDP91972 iron-compound ABC transporter, iron-compound-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100003825 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  16  1MKTLYFTALVASFLLLLGACSTNSSTSQTETSSSAPTEVTIKSSLD----EVKLSKVPEKIVTFDLGAADTIRALGFAKNIVG--MPTKTVPTYLKDLVGTVKNV-----SMKEPDLEAIAALEPDLIIASPRTQKFVDKFKEIAPTVLFQASKDDYWTS....... 153
20 -17.200IDP05272 hypothetical protein lmo1649 [Listeria monocytogenes EGD-e] lmo1649 [Listeria monocytogenes EGD-e]  ali follow..  11  1MKKWLLVVLTLALGLSLAACSGSNSSDKKEDTKKETTSDKDKVLNYYMDLVDVVNENNGDYN--------AYVGAVGADPKPSEADLAALAKPASESALKVSEALASEKTPDLGKSTDDFKAAVKQLSDAYKLEADALKASGRDTTKAD-EAIASVLKDAGLNPSS. 164
21 -17.200IDP05442 putative lipoprotein [Bacillus anthracis str. Ames] BA_0171 [Bacillus anthracis str. Ames]  ali follow..  23  1MSKLSLFSAVIVAAFVITGCGQSDTTNKEQKENAAKENKTEKTDTTKENKP.................................................................................................................... 53
22 -17.100IDP05429 hypothetical protein lmo0791 [Listeria monocytogenes EGD-e] lmo0791 [Listeria monocytogenes EGD-e]  ali follow..  16  1MKKLFSMVLVLAMVLVLSACGASRVE---PKKAGEITVNAVVYNKDTDKVKDVYGEDGSKFEKEFETSFKESFISTFTASFSSDVNLDKQVDEFYDALRKQVNEKTSYTTKVTNDDKE-SPEIQFAIKGLDMKGVQT.............................. 134
23 -16.700IDP05454 putative lipoprotein [Bacillus anthracis str. Ames] BA_0190 [Bacillus anthracis str. Ames]  ali follow..  13  1MRTLLSVLLALMLVPALTGCKAPAKEDTTSNKKTTEEAKNETPADLKNEFSLDADYQDT---KKDYEADYKNVAADKKMEAKIEDHKADVNLTGDEAITKLSPLLQELKFDKGTPDQEVIDQVLNVFKLDKDYQKFELEVVFSDGTKKEYKREIK............ 155
24 -16.500IDP05242 hypothetical protein lmo2079 [Listeria monocytogenes EGD-e] lmo2079 [Listeria monocytogenes EGD-e]  ali follow..  17  1MKKGILLSILLALVLVISACGESAEEKAAKTPQGKFVQTMKNGMNVPDQYTYTTSFAVNDI------------NVSSTDPSAQTMGILKDIKLSVTTSTDKKANKSEAKFNVTSTNNLLPISMDLDF........................................ 115
25 -16.300IDP05125 putative lipoprotein [Bacillus anthracis str. Ames] BA_4310 [Bacillus anthracis str. Ames]  ali follow..  14  1MKKLI--MTLFIAMLALAGCNTNKEEPKKEQKLEAVKVAVQTNPKEKTEVQALVTQGKEKVTD........................................................................................................ 66
26 -16.300IDP05483 putative lipoprotein [Bacillus anthracis str. Ames] BA_3005 [Bacillus anthracis str. Ames]  ali follow..  11  1MRRMLLIIISAIAAFALAACTGNKVDESTSKNFISKAEEIVSLLNEAKYKEVHEKFDSKMTAALSEEKMKDL----------PIIEKAGTFEKIEKQSIEEKDGLYTVILVAKYSKEQRTFIITYN......................................... 117
27 -16.200IDP05050 iron compound ABC transporter, iron compound-binding protein [Bacillus anthracis str. Ames] BA_5330 [Bacillus anthracis str. Ames]  ali follow..  12  1MLLKL-VSILAIFTLMLVACSDSGKETSKATKDNSSDKPK-TVEITDAHGKVKVPVNPKNVVALDNRTFETLADWGIKLAAAPKDIMPADSAYKKDEKVQNI--------NHREPNLEIIAAANPELVIVGQRFADHYEEIKKLVPNAAVIDLNVDVSEKATKPGEN 158
28 -16.200IDP04370 iron compound ABC transporter, iron compound-binding protein [Bacillus anthracis str. `Ames Ancestor`] GBAA4766 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  1MKKIL--SIFIVVFLFAVGCGQQKEEKKETKADNKNQAITIKHAEG----ETKLDKPAKKVVVLEWVYSEDLLALGVQPVGMADIKNYNKWVNTKTKPSKDVVDVG----TRQQPNLEEISRLKPDLIITAKNELEQIAPTPSTSNNDHFAEMTETFKQIA...... 162
29 -15.900IDP05554 hypothetical protein CD3669 [Clostridium difficile 630] CD3669 [Peptoclostridium difficile 630]  ali follow..  16  3NKKIMLVLSILSISIFAVGCTNAQNGSDSSKKETKSNTNVEQPKEENNTEKEVPNNKAKPTETKAQSATIYSFDVDKTDLIENKVDLNKIDENTLFEEVPESAKLNSFTTKDIDGVKTGILDVSSDFTKSNLGSDAETLMLDSVARTYIKNMNVEQIKESGHIVLEE 186
30 -15.800IDP91154 hypothetical protein SAOUHSC_00808 [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00808 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  22  1MKKVM--GILLASTLILGACGHHQDSAKKESTSHKKKENDNEELNEELKEF.................................................................................................................... 49
31 -15.400IDP05480 putative lipoprotein [Bacillus anthracis str. Ames] BA_3532 [Bacillus anthracis str. Ames]  ali follow..  36  1MKKKLTILFSIVCILVLAACGQTKANKEETKKVMSQKS................................................................................................................................. 38
32 -15.200IDP00820 iron compound ABC transporter, iron compound-binding protein SACOL2167 [Staphylococcus aureus subsp. aureus COL]  ali follow..  20  1MRKTFSILGLIVALLLVAACGNTDNSSKKESSTKDTISVKDENG------TVKVPKDAKRIVVLEYSFADALAALDVKPVGIADDGKKKRIIKPVREKIGDYTSV-----TRKQPNLEEISKLKPDLIIADSSRHKGIKELNKIAPTLSLKSFDGDYKQ........ 152
33 -15.100IDP04408 iron(III) ABC transporter, iron(III)-binding protein [Clostridium perfringens ATCC 13124] CPF_1426 [Clostridium perfringens ATCC 13124]  ali follow..  15  1MRRLGLATIGLVFSLALAGCTGSSKESTASKNTEEGYPVTISTDQSGKEFQETFESKPKRVISTNQTTTEIMLDLDLQDSLVGTSFMDSPILPRLEDKYKNINVL-----SETYPSKEAVLALNPDLNLGSVESWNEKGRNSGISKEQTLDDVYYDINDIG...... 177
34 -14.900IDP91955 ABC transporter substrate-binding protein - iron transport [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100006939 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  11  1MKNKFFLIAILAMCIVFSACSSNSVKNEENTSKEHAPDKIVLDHAFG---QTILDKKPERVATIAWGNHDVALALGIVPVGFSKANYGVSADKGVLPWTEEKIKELNGKANLDGLNFEAISNSKPDVTKEDYDTLSKIAPVAAYKSKPWQTLWRDMIKIDS...... 170
35 -14.900IDP00755 gene: sirA; iron compound ABC transporter, iron compound-binding protein SirA SACOL0099 [Staphylococcus aureus subsp. aureus COL]  ali follow..  14  1MNKIKMLVVTLAFLLVLAGCSGNSNKQSSDNKDKETTSIKHAM-------TTEIKGKPKRVVTLYQGATDVAVSLGVKPVGAVESWTQKPKFEYIKNDLKDTKIVG----QEPAPNLEEISKLKPDLNEKVYDQLSKIAPTVSTDTVFKFKDTTKLMKALGKEKEAE 166
36 -14.900IDP04564 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1610 [Clostridium perfringens ATCC 13124]  ali follow..  15  1MKKVSLIFIALSFALLFLGCGNNNEASRYSSTGDRDTMESF-----GVDGQFAIYKFSDENFNKKLDL--------------------DTKNQDAIDIISNYKEIEPYVYTIGEKG------TKLNYANGNLIQSNDLNKFSNNDKAI-FEDLNK............ 125
37 -14.700IDP05486 putative lipoprotein [Bacillus anthracis str. Ames] BA_4573 [Bacillus anthracis str. Ames]  ali follow..  15  1MRAFFGIGPFLIVVLLLVGCQSEENKIEQKATTTKAEEKVQITKEEEKSIQDVMDKFVRTTNEKNLAEHIELFSKKMPSAEDLKTQKEAAFQK.......................................................................... 94
38 -14.600IDP91374 outermembrane lipoprotein [Vibrio vulnificus CMCP6] VV1_1919 [Vibrio vulnificus CMCP6]  ali follow..  18  1MKNI---GLLLLASLFLAGCTTPTHLPLSGSQAIE.................................................................................................................................... 32
39 -14.500IDP05366 putative substrate-binding family protein [Bacillus anthracis str. Ames] BA_2255 [Bacillus anthracis str. Ames]  ali follow..  11  1MTRNMLIFCIMLLTIIIAGCSKEEKKENDTSAKAKDSYTI-----KHAMGETTVDGTPKRVVVLTNEGAEALLSVGVTPVGTTKPRAGDEWYPHLAKELKNTKVVG----TERDINLEAVMKLQPDLIIGNKMRHEKYEQLKEIAPTVYAETLRGDWKEN....... 154
40 -14.300IDP05369 iron compound ABC transporter, iron compound-binding protein [Bacillus anthracis str. Ames] BA_4597 [Bacillus anthracis str. Ames]  ali follow..  19  1MKKITLFTAILSIFFLLIGCSAKGDEKASATKTEKGKEKIEVTDLSGR--KVTFDKVPESFATLSMGDMNIIHALGGKIVGRPDAKI---------TLPEDIKKIQVIG-NAHQPNFEQIASLKPDVLIANNGFQKNIPTVEGQGTKVSVQDIQKNIELYG...... 156
41 -14.200IDP05715 iron compound ABC transporter, iron compound-binding protein [Bacillus anthracis str. Ames] BA_0351 [Bacillus anthracis str. Ames]  ali follow..  18  1MKKLF-ISLTVLFVLVMSACSNGSTDKKNDAKGSKSETITYQSENG----KVEVPANPKRVVVLGNVMSLGVNLVGVDSWSKQNPRFDSKLKDV----------------EVSDENVEKIAELNPDL--IGLSNIKNVDKLKKIAPTVTYTYGKVDYLTQ....... 143
42 -14.100IDP05448 hypothetical protein lmo2594 [Listeria monocytogenes EGD-e] lmo2594 [Listeria monocytogenes EGD-e]  ali follow..  33  1MKKTS-IIFIFCTLLFVTACSTSENQTQATE........................................................................................................................................ 30
43 -14.000IDP04088 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_2931 [Clostridium perfringens ATCC 13124]  ali follow..  12  1MKKGM--ILLILSSFLLVGCDSIKMDKLAANNNERVKTIA---NDLIGDIDLSLYFDGTK----------DEQNPKIEQQEILVDGDEILGQYLIQALIQGPSQKGSLAPILPKDTKLLSFDIKDDIAIINLSK-EAIVNMSATKEQATLEGIIATITQ........ 143
44 -13.900IDP05508 putative lipoprotein [Bacillus anthracis str. Ames] BA_5398 [Bacillus anthracis str. Ames]  ali follow..  1MTIRKRTSFIWIFLFSLVACSPPNTTIDKKEQVKVDKIRIVHYTHEGDPIFQTLERSKNDILYASDNRKDQFDG............................................................................................. 97
45 -13.800IDP05503 putative lipoprotein [Bacillus anthracis str. Ames] BA_4863 [Bacillus anthracis str. Ames]  ali follow..  13  1MKRA---LFFFISIFFLGSCSIWYVTFSSESKS--TGQYKGHIKDDSEDGMFTFRYKGGDGNTEFKNLEIAINGAFSTMTQTSENHKGAKIEM----------KSSCVSCAPLSKDEPIEIVIKWDDKYEEKMVLKR.............................. 123
46 -13.600IDP04565 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1805 [Clostridium perfringens ATCC 13124]  ali follow..  10  2IKKIVVAVGLAFSLSFLVGCGNKSLVEQGKAAIKQGN---YEEATAIFKAASEEDSKDKEEAESLYDLTYNYVISNKAYNEFKLDVALDSLKKVEE....................................................................... 94
47 -13.600IDP05607 putative lipoprotein [Bacillus anthracis str. Ames] BA_4862 [Bacillus anthracis str. Ames]  ali follow..  17  5MKFSM-FMFLGVVLIILAACTTKSVEQVAVKEVPKEGYIILRNETV......................................................................................................................... 49
48 -13.600IDP90329 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_548 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  19  1MLKMFWLNSLVFFSLLLSACGYTVLSPHYVEKKFSLSEGIYVCPIEGDSLGDLVSSLSYELEKRGLHTRSQGTSSGYVLKVSLFNETDENIG----AYTPQKPDEKPVKHFIVSNEGRLALSAKVQLIKNRTQEI................................ 132
49 -13.500IDP05029 putative lipoprotein [Bacillus anthracis str. Ames] BA_0864 [Bacillus anthracis str. Ames]  ali follow..  10  1MKKYTLYSLMLLTLLFLSACSNSAQPKEENDVQSIKDETIFTSSKKNETIN-TYLDYSGELYENTVPLSSAMSDEKVTESDREKLQKLIDLAQQNDANFHHFISNNTIPHDYKQPSKEIHDYISLAEDGNLFKTDFSFTKRFEKVNGRKQKEIEKFLKEKKIETE.. 194
50 -13.400IDP05476 putative lipoprotein [Bacillus anthracis str. Ames] BA_2745 [Bacillus anthracis str. Ames]  ali follow..  17  1MKKSTLILCSLCLGFSMTACEQKKEVKKQTATSSTVMENQKKESININHFNINEGMTYKEVKDL------------IGFEGDLLIEEGVEHSTQIKQIFAWKGSNPTALVEITFLDGKVHSKVQQGLS....................................... 117
51 -13.400IDP05430 hypothetical protein lmo1265 [Listeria monocytogenes EGD-e] lmo1265 [Listeria monocytogenes EGD-e]  ali follow..  17  1MKNRITMIAGIVCLSILTACSSSESVKGTTSEEQTTSQSGAEMIKANNGVVSYLEKDAPIIIK........................................................................................................ 76
52 -13.300IDP01305 lipoprotein-related protein VC1064 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  23  1MKKVLLIVISILFGSVLVGCQMNESNKTQDKIQSITGSVAYRERIDNAVVTVYLQ................................................................................................................ 58
53 -13.200IDP06544 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09718 [Enterococcus faecium DO]  ali follow..  11  1MKKIIVTTCLLATGFLLTACGESQSSNESQQTTIQFMHSSVEQERLSVINELVADFEKENPDIKIKQVPVEESAFNTKIVTLARSGKLPEVMEVSQDFAKVMDKIDQTAVQNVIEEAGEDNYYDGAKNLVRSEDGKSYIAAPISGWVQGIWYDKEKLSEAGFSEPEN 170
54 -13.100IDP06159 hypothetical protein jhp0866 [Helicobacter pylori J99] NP_223584 [Helicobacter pylori J99]  ali follow..  10  1MNRLAFLGLIVGVLFFFSACQHRLHMGYYSEVTNYNSTIVVAYDRSDAMTSYYINVIVYELQKLGFYNVFTQAEFPLDKAKNVIYVRIVRNISAVPFYQYNYQLIDAINGFSEQILMSANSHFILDWYDVVLQKRVLYVDGSVSGRTCGYQMLYRDLIKSTIKRID. 197
55 -13.000IDP05451 putative lipoprotein [Bacillus anthracis str. Ames] BA_0580 [Bacillus anthracis str. Ames]  ali follow..  32  1MKKI---GTMLLFSILIAGCTQAQPDLKKPKKEAIATSST............................................................................................................................... 37
56 -13.000IDP05001 putative lipoprotein [Bacillus anthracis str. Ames] BA_1090 [Bacillus anthracis str. Ames]  ali follow..  24  1MKRVMYVVLLLSFVIGMTACNDETSSSRT.......................................................................................................................................... 29
57 -12.900IDP06507 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN11122 [Enterococcus faecium DO]  ali follow..  14  1MKKIVMMGVALVSGLVLAGCGNGSASNSDKVEISKKAMDNAKKEFSDYKLSFKQIPANDDFDTKLKA--------SLNSKSAPDITAINSNISDYLPYADKFVNLLDYDSETLAAD------VEWKWDSCFTNDKKTQIAMPIDIGPTALFYNVDAFAKAGLPTNDQ 166
58 -12.900IDP05563 hypothetical protein lmo2417 [Listeria monocytogenes EGD-e] lmo2417 [Listeria monocytogenes EGD-e]  ali follow..  13  1MKKVLGLIFTLSLVLVLTACGGSSDKASSSKDDKQLVVGASNTPHAQI----------EQAKPILKDKGIDLKIVKYTDYVMPNKALEEGDLDA-----NYFQHKPYLELEEKEKGYKFADVGAIHIEPMDIKDLKDGAQVLLSNSKSDWPRVIGIFVDNGLLTLKD 161
59 -12.900IDP05404 iron compound ABC transporter, iron compound-binding protein [Bacillus anthracis str. Ames] BA_5628 [Bacillus anthracis str. Ames]  ali follow..  15  4FKMALLAMVLVVTSVLFAACSNKEEKKADAKDAKTEERTV-----QHAKGEIKIPANPKKIADLSGSTE-ELLIFGMKPIITAN-TSQEKIDAHIEKKLKDVKPVG--SAWGDKINIEAVAAAKPDLILVNNRQEKIYDQLSKIAPTVMLKTPLDQWRPK....... 154
60 -12.900IDP05227 hypothetical protein lmo0541 [Listeria monocytogenes EGD-e] lmo0541 [Listeria monocytogenes EGD-e]  ali follow..  17  4KHKWAAILMTVLLAVVLTACGSSSDKDSSKEKESATKTVT-----DTTDRKVEVPTTPKRIVALQNVSEM---ILGVKPVG-----TTDYYITTYPDATKGTESVGNDKPSIEK-----IANLKPDLIIISDYQKDLLENLEKVAPVYITHTPDKQLSNIA...... 150
61 -12.900IDP05622 ABC transporter, substrate-binding lipoprotein [Clostridium difficile 630] CD0999 [Peptoclostridium difficile 630]  ali follow..  13  1MKKISIILLVVLTMVVLVGCSPGKDNPKNKELSVVKQVKV-PEIKEGYETVYSIEKTPEAISTRVMKKDADIAIVPSNMAAIAYNKTSSSLYLVSTENIKDYSDLVGKEVGCTGKGLSLLLQKDINYSDIKFNYVSS.............................. 172
62 -12.900IDP05444 hypothetical protein lmo0768 [Listeria monocytogenes EGD-e] lmo0768 [Listeria monocytogenes EGD-e]  ali follow..  14  1MKKVLLAILSMVLLLSLAACGGSSDSSKDKNGKEE-EKQIDSYNKSQDKYKVKYVMQENVEEKLLTGIA-LYAPKGVLEPLDKLVKEDNLKMDDFYEESVKEMTYSDKLYGLPLLNDNRILFYNKKLQEAGVKPPTTWDELATAAQKTT.................. 179
63 -12.800IDP05268 hypothetical protein lmo0366 [Listeria monocytogenes EGD-e] lmo0366 [Listeria monocytogenes EGD-e]  ali follow..  20  1MKKLIIVMLTIFTAVLVVGCSGTGTADKAETKKETTKESKQANAVKKEVKEMK.................................................................................................................. 53
64 -12.700IDP90095 ZZZ_0011 [Escherichia coli 042]  ali follow..  10  2MTIKCLLLAVMVCPFFITACSDKYSEQDRVQAINNAD------PFGAGLLTFQISSDTQALLFLQASDKNTLQDIMNNPVLIKQFFIGTGKVDGILKVDKYV---QEITLHIDRNEGTKYVGVVAGYYPFPGKQHMLL............................. 146
65 -12.700IDP00144 gene: viuP; vibriobactin and enterobactin ABC transporter, periplasmic ferric vibriobactin/enterobactin-binding protein VC0776 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  1MRINITMKNIFILLSVILGCLFSGFVSAQQNVWPRT--------QNADGSITTIPSQPKRILSTAVTVTGTLLAIDAPVIASAATTQSTFFEQWRKLAELRQVKKLWPAGSVDLES---VYVEQPDLIVVSMSARDQIPLLQAIAPTILVDYSDQTWQSLGLEEQAE 169
66 -12.600IDP05275 hypothetical protein lmo2686 [Listeria monocytogenes EGD-e] lmo2686 [Listeria monocytogenes EGD-e]  ali follow..  11  1MKEFLFFAVFTFIMTIGVGVNASASEIENPDNIQEAEVETFDLNGNIAQEKEIVLEDGTEGT------------LGVMPIIDERPLLKGTYSLANGT-----------TWKIYWYSGVYNCSFNAKINVSKGKG................................. 113
67 -12.600IDP00148 gene: vctP; vibriobactin and enterobactin ABC transporter, periplasmic vibriobactin/enterobactin-binding protein VCA0227 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  4IIVRTLLMRISIKMIPLAYLNHFRKEHMKSRIHWAALGLLAAFAAQAETVTITLEQKPQRVVVIGVGALDAIDSFGIEPVAVSKFDGTPDYLA--KYKSDKYPSA-----SLFEPDFETIYTQKPDLIVIGPRASKSYDELSKIAPTIVFA................ 155
68 -12.600IDP06519 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09962 [Enterococcus faecium DO]  ali follow..  10  1MKKLVIALLNITLLFSLSACGKTNEEVTANIADPMIKKAT----------TLEVYVANGKLTNYVENAAKIYNRIDLKIVNVASGTATVQMITPKLVTHEDMPDIISMADTYSADEYGFYDKYGDQFYDQKLNILRTIIPWASDFTPALCYYQPKKFAEIGVDFEE. 183
69 -12.500IDP05507 putative lipoprotein [Bacillus anthracis str. Ames] BA_5374 [Bacillus anthracis str. Ames]  ali follow..  10  1MRKGLITALFALLFSSFTGCDNSPLDKKVKEEAKRTEKEKGPKLTKMSTES-----FNQSISQGAKKRALAMDGIIKSAAVNSNLDLYIAVIPEHHERFGLKPLRKKLQKQLSDEHPTFDVRVSTDKK---FMLLEKLERKIKEKEVSKINKQLKFIGK........ 155
70 -12.500IDP04234 iron compound ABC transporter, iron compound-binding protein [Clostridium perfringens ATCC 13124] CPF_0807 [Clostridium perfringens ATCC 13124]  ali follow..  13  4LKKLAILGIATLTVGMFVGCSSSKTSEEGNTSNE-------KRIVQSVKGEVEIPANPKKIVDISGSSE-ELVLLGHTPVATANVDSYKT-DQVPEYMAETLKDTKIVGHMMDTADIEGILSVEPDLIIMSPRQEKIYDQLAEIAPTVIINDNANDWEAK....... 155
71 -12.500IDP93852 lipoprotein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005559 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  16  1MKAIF-AVCAVMMALLLTGCAKPVSQDYSAFKQSKPKSILVLLPQNQSPVTYPLSEAGYYVLPVAVVEET-FKQNGMTNAADISAVSPAKLHKIFGADAALYITIVQYGTSYQILTSDTRVTANAKLVDLKTGKL................................ 144
72 -12.500IDP05449 hypothetical protein lmo2595 [Listeria monocytogenes EGD-e] lmo2595 [Listeria monocytogenes EGD-e]  ali follow..  25  1MKKLLLVSVLMLFIFLTVACGSSEDNEESGEISTKEDDPIIPTDENGVDPKSKLTIDGKAVKK........................................................................................................ 77
73 -12.400IDP91953 extracellular solute-binding lipoprotein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100002215 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  10  3FRKLACTVLASAAVLGLAACGNSGGSKDAGKSGGDGAKTEITWAFPVFTQEKTGDGVGTYEKSIIEAFEKANPDVKVKLETIDFKSGPEKITTAIEAGTAPDVLFDAPGRIIQYGKNGKLAELN-DLFTDDFVK-DKAYMYPISSAPFYMAMNKKMLEDAGVANLVK 182
74 -12.400IDP05612 putative lipoprotein [Bacillus anthracis str. Ames] BA_5233 [Bacillus anthracis str. Ames]  ali follow..  11  2LKTIKNTLLFFLCLVVLSGCFTREGTIVGGKVHGGSNSIDGKYKSFTGFATQDMDVKKGESWTFTFEDKTKQGTIKAY----LDSNDNTILEVNSGNSKNNIKVSKDDTYKVKIITEEHGGEFEISWKK...................................... 127
75 -12.400IDP91126 extracellular solute-binding protein, putative [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00176 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  26  1MSKLKCITLAVVMLLIVTACGPNRSKEDIDKALNKDNS-------KDKPNQLTMWVDGDKQMAFYKKITDQYTK............................................................................................. 68

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.