current user: public

If you have questions about the server, please let us know.

Query: IDP05354 hypothetical protein CD3043 [Clostridium difficile 630] CD3043 [Peptoclostridium difficile 630], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst MITTIVLISGMSMTVYGMTAKEVTAKTPKSYVTGTNSVYGPKLSQAQLNSVAQATADFMNKKITKNMTTDAKILVAYNHIKNNTTYVDWNAVEGANTAYTLVTKKGACSGMARSMKALCDAMGIESYYVHSTSNDHQWNLIRFGDGRLYHVDIDANKSAGKDIIYKSLSHPLPFDKTAYPKVGAIVQTVKPEQTQKPAPPGKHTMLPHQEGAKAVGNFGKKGEDINEKHVMYEGVRCSVVNSSVNTITFTGSESNLDPSNLTIAVIGFMNTPYGMFALAPEGKPVEYPFKYDKPFSLDFSGKNRSGAELAKYCKKNDVTIKIEITDEKANIGLGQIMYVRYELast
1 -89.800IDP05354 hypothetical protein CD3043 [Clostridium difficile 630] CD3043 [Peptoclostridium difficile 630]  ali  100  1MITTIVLISGMSMTVYGMTAKEVTAKTPKSYVTGTNSVYGPKLSQAQLNSVAQATADFMNKKITKNMTTDAKILVAYNHIKNNTTYVDWNAVEGANTAYTLVTKKGACSGMARSMKALCDAMGIESYYVHSTSNDHQWNLIRFGDGRLYHVDIDANKSAGKDIIYKSLSHPLPFDKTAYPKVGAIVQTVKPEQTQKPAPPGKHTMLPHQEGAKAVGNFGKKGEDINEKHVMYEGVRCSVVNSSVNTITFTGSESNLDPSNLTIAVIGFMNTPYGMFALAPEGKPVEYPFKYDKPFSLDFSGKNRSGAELAKYCKKNDVTIKIEITDEKANIGLGQIMYVRYE 342
2 -73.400IDP95076 hypothetical protein CD630_11560 [Peptoclostridium difficile 630] YP_001087648 [Peptoclostridium difficile 630]  ali follow..  70  7.LATKLLIATMVLTSYGMTAKDVTAKTPKSYVAGTNSIYGPKLSQAQLNSVAQATADFMNKKITKNMTTDAKIRVAYNHIKNNTTYVNWNAAEGANTAYTLVTKKGACSGMCRSLKALCDAMGIECYYVHSTTNDHQWNLIRFEDGRLYHVDIDANKSAGADIIYKSLTHPLPFDKKAYPAVGEVVKTQNPTPTVKKPTPAKPSAPVGPGNHTMIADQQGAINNLRPKIEMYEGVPCSLINSSINTIKFTSKNSNLDPSKHTVTVIGFMNTPYGMVALAPDGVPDEYPFEYDKPFSLDFTGKNLSAAELSKKCKENNVIIKVEIGETASNSGRGMVAYARY. 358
3 -59.500IDP02574 protease, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA1995 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  85.EFNKIVDADEYVKYN--IASTRYSIKGLPGNYTFTLQVKYRESKEQTQYVKSQAKAIIGSIVKPGMDEHEKVKAIHDYVVKHVSYDTSY--QAYTAYEALANRSAVCQGYTLLTYELLKEAGIQNRIVTGTGNGHSWNLVNI-ENKWYHLDTTFDDPVPDKVTYSYFNMSDEQLSKDHPAATTSYFNELTNKIKAGSSKTATYEQMLKETNLKYLSAQYGADNYSE................................................................................................................... 317
4 -11.100IDP91270 acetyltransf2, N-acetyltransferase [Bacillus anthracis str. Sterne] NT05BA3459 [Bacillus anthracis str. Sterne]  ali follow..  12  1..................................................MTDFQKQFFARL-EKQKVSFEDLSNIMYAMAQTVPFENFKEISQENLKEKILVNNGLCYELNPTMYYFLKDAGFDVYLVSGTDSGHIATILKH-HNELYLIEVGFGS......................................................................................................................................................................................... 128
5 -7.350IDP02599 putative galactosyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1138 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  12  12.................................................NVEKYLKECLDSVINQTYTNLEII------LVNDGSTDENSLN--------------IAKEYTLKDKRI-KNGGL----------SSARNVIEYFSGEYKKNKT--QTIKENSLIEFNIEGNNP......................................................................................................................................................................... 109
6 -7.290IDP01973 putative sugar transferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1440c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  12.................................................NVEKYLRECLDSVVNQTYKNLQVV------LVNDGSTDENSLN--------------IAKEYTLKDERF-ENGGQ----------STARNVIEFFSKEYDKNIT--QELKENSLVEFKLDNEDN......................................................................................................................................................................... 109
7 -7.280IDP01764 putative sugar transferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1434c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  17.................................................NSISYIRECIDSILNQTLKDIE-ILCIDA--------------------NSTDGTLEVLKNYEK------KDKRLRVIISDKKSYGYQMNLIKEAKGEYLIVES--DDYIKTNMYERLYEIAKKNDCE..................................................................................................................................................................... 117
8 -7.130IDP02173 putative galactosyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1136 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  12  12.................................................NVEKYLKECLDSVINQTYTNLEII------LVNDGSTDENSLN--------------IAKEYTLKDKRI-KNGGL----------SSARNVIEYFSGEYQYIEK--EN......................................................................................................................................................................................... 94
9 -6.810IDP02264 putative sugar transferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1438c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  17.................................................NSISYIRECIDSILNQTLKDIE-ILCIDA--------------------NSTDGTLEVLKNYEK------KDKRLRVIISDKKSYGYQMNLIKEAKGEYLIVES--DDYIKTNMYERLYEIAKKNDCE..................................................................................................................................................................... 117
10 -6.650IDP95239 gene: wagN; WagN [Acinetobacter baumannii] AHB32491 [Acinetobacter baumannii]  ali follow..  12  13.................................................NRAHTLPRVYQSLKEQTLQNFEWL------IIDDGSVD---------------DTEKVVSEFIN------QKLKIRYIKQENVGKQAAWNKIAMAEGRIFCLDS--DD......................................................................................................................................................................................... 94

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.