current user: public

If you have questions about the server, please let us know.

Query: IDP05442 putative lipoprotein [Bacillus anthracis str. Ames] BA_0171 [Bacillus anthracis str. Ames], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst MSKKLLSLFSAVIVAAFVITGCGQSDTTNKEQKENAAKENKTEKTDTTKENKPEEKNPKTRKLKIKRRKIPLLAPAIILNLFPTWKKKQAEKQKFFLKIRNHKSINLKMFQYRLast
1 -52.200IDP05442 putative lipoprotein [Bacillus anthracis str. Ames] BA_0171 [Bacillus anthracis str. Ames]  ali  100  1MSKKLLSLFSAVIVAAFVITGCGQSDTTNKEQKENAAKENKTEKTDTTKENKPEEKNPKTRKLKIKRRKIPLLAPAIILNLFPTWKKKQAEKQKFFLKIRNHKSINLKMFQYR 113
2 -27.500IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames]  ali follow..  25  1MLKKLGILVLGSAVALS-LVACGDSTKEASNEKKEEPKQEAKKENKENKESKKKITAAD...................................................... 58
3 -25.300IDP04197 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_2510 [Clostridium perfringens ATCC 13124]  ali follow..  12  1MKKLLVPVLVIIIFAL-LFVGCTNSSNSSSDSSVEIINSNQQNSNSNNNNSSNNDTKKSDSNNASHKDNKDN......................................... 71
4 -21.800IDP05763 hypothetical protein lmo2331 [Listeria monocytogenes EGD-e] lmo2331 [Listeria monocytogenes EGD-e]  ali follow..  25  1MKKGIALLAGFMLAFSIFLTGCGGTDNTRKENHSDGSAEVKNKKDNNTSDEYVEDGLLLKVGE.................................................. 63
5 -21.400IDP05121 conserved hypothetical protein [Bacillus anthracis str. Ames] BA_0915 [Bacillus anthracis str. Ames]  ali follow..  16  1MLKKFTTCILGGALVF-NLSGCGNTSDKTSSESKETNSKQEEKNVQTTDEAKTKENTKQKNTEQTKEKSKIK......................................... 71
6 -20.600IDP05588 putative lipoprotein [Bacillus anthracis str. Ames] BA_2883 [Bacillus anthracis str. Ames]  ali follow..  12  1MKVVKIALLCLTFTCIFALAACKGTDEKKETNPTSENSKNEQNTSSEGKKEPEVKSNTDSNSKDIVINQKSI......................................... 73
7 -20.400IDP05554 hypothetical protein CD3669 [Clostridium difficile 630] CD3669 [Peptoclostridium difficile 630]  ali follow..  15  1MKNKKIMLVLSILSISIFAVGCTNAQNGSDSSKKETKSNTNVEQPKEENNTEKEVPNNKAKPTPKEETKAQS......................................... 72
8 -20.300IDP05677 hypothetical protein lmo1068 [Listeria monocytogenes EGD-e] lmo1068 [Listeria monocytogenes EGD-e]  ali follow..  10  1MKK--WMVIISIISLVALLGACGNNDNEKDQEDKSTTDSTTKKAKSSSNESNKAAETKENDTNDKAATTDKG......................................... 70
9 -19.900IDP05009 putative lipoprotein [Bacillus anthracis str. Ames] BA_4237 [Bacillus anthracis str. Ames]  ali follow..  1MKAWKS--IFVLCSFLLMLSGCFHQEEKKVEPKKKESIPETKEYGGRELKKVGQKVKETGWGT.................................................. 61
10 -19.100IDP02672 hypothetical protein FTT1602 [Francisella tularensis subsp. tularensis SCHU S4] FTT1602 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  14  1MKKQLFAISITTALLV--LSACGQTGPLYLPDEDKLNSGSTLAKSGSSIMVKQNQQNNSTSTSDNQSDTSTK......................................... 70
11 -18.600IDP04058 ABC transporter, solute-binding protein [Clostridium perfringens ATCC 13124] CPF_0556 [Clostridium perfringens ATCC 13124]  ali follow..  14  1MKRKMLTVACVTAIAASAFVGCGNKEEAPKDNEKPSTEQAEGSGEKKVLEIAVFEGGFGKDYWDACIDAFEAEHPDVEVKM................................ 84
12 -18.300IDP05148 putative lipoprotein [Bacillus anthracis str. Ames] BA_0177 [Bacillus anthracis str. Ames]  ali follow..  18  1MKK--IIFVSSLVLAISLGVGCSNEKTAKTDEPKKESVQKEKELTAKDVFKKTNEAFKNEEH................................................... 60
13 -18.000IDP05670 hypothetical protein lmo0617 [Listeria monocytogenes EGD-e] lmo0617 [Listeria monocytogenes EGD-e]  ali follow..  25  1MKKKSILLLMGIITFALALTACGGTEDKASTEKIETAKAETKKKSNPNELGD............................................................. 53
14 -17.900IDP05429 hypothetical protein lmo0791 [Listeria monocytogenes EGD-e] lmo0791 [Listeria monocytogenes EGD-e]  ali follow..  21  1MKKGLFSMVLVLAMVL-VLSACGASRVEPKKAGEITVNAVVYNKDTDKVKDVYGEDGSKFEKEFET............................................... 65
15 -17.800IDP04242 sugar ABC transporter, sugar-binding protein [Clostridium perfringens ATCC 13124] CPF_1113 [Clostridium perfringens ATCC 13124]  ali follow..  26  1MRKKILSAILCMMIGATAMVGCGDKTDSTQAKDGGKVK........................................................................... 38
16 -17.300IDP05010 putative lipoprotein [Bacillus anthracis str. Ames] BA_4934 [Bacillus anthracis str. Ames]  ali follow..  26  1M-KKVLMLFVLLLTASILLIGCSTKKEKAGMNLEKAQKVEIESLTDSSEKKVITDKKE....................................................... 57
17 -17.200IDP05267 hypothetical protein lmo0255 [Listeria monocytogenes EGD-e] lmo0255 [Listeria monocytogenes EGD-e]  ali follow..  23  1MKK--FLSILSILVLALLVTACGSDSSDKKSAKKEEKMETVTYIADINGAKLE............................................................ 51
18 -16.900IDP91154 hypothetical protein SAOUHSC_00808 [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00808 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  16  1M-KKVMGILLASTL---ILGACGHHQDSAKKESTSHKKKENDNEELNEELKEFKSKKNMD..................................................... 56
19 -16.500IDP04198 oligopeptide/dipeptide ABC transporter, oligopeptide/dipeptide-binding protein [Clostridium perfringens ATCC 13124] CPF_2555 [Clostridium perfringens ATCC 13124]  ali follow..  17  1MKKRKLVALLTAGLAASMFVACGGGANNTAQGNGNGSESGGTTKDLSKPERIEASNPSALPDAAKNRTDT........................................... 71
20 -16.200IDP91953 extracellular solute-binding lipoprotein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100002215 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  16  1MKFRKLACTVLASAAVLGLAACGNSGGSKDAGKSGGDGAKTE....................................................................... 42
21 -16.000IDP04063 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_0514 [Clostridium perfringens ATCC 13124]  ali follow..  12  1MNRKIVASILTTSLLVTSLVGCVGSNNKANTSSNDSKVQESVENQSDFND............................................................... 51
22 -16.000IDP92625 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19F] SpneCMD_010100009638 [Streptococcus pneumoniae str. Canada MDR_19F]  ali follow..  14  1MKKKYAFASASVVALAAGLAACGNLTGNSKKAADSGDKPVIKMYQIGDKPDNLDELLANANKIIEE---------KVGAKLDIQYLGWGDYGKKMSVITSSGENYDI...... 100
23 -15.700IDP04249 putative galactoside ABC transporter, galactoside-binding protein [Clostridium perfringens ATCC 13124] CPF_1548 [Clostridium perfringens ATCC 13124]  ali follow..  19  1MKKKGLALILISALTMGTLVGCGGGSGSTGSSGDTPKENDS........................................................................ 41
24 -15.600IDP05098 putative outer membrane lipoprotein [Clostridium difficile 630] CD0569 [Peptoclostridium difficile 630]  ali follow..  19  1MRKRILILMLTVAMIAGMLVGCANNPSNNPSSSKDNKSDISDKSNSK.................................................................. 48
25 -15.500IDP05125 putative lipoprotein [Bacillus anthracis str. Ames] BA_4310 [Bacillus anthracis str. Ames]  ali follow..  17  1MKKLIMTLFIAMLA----LAGCNTNKEEPKKEQKLEAVKVAVQTNPKEIKPGEKTE......................................................... 52
26 -15.400IDP05525 putative sugar transporter, substrate-binding lipoprotein [Clostridium difficile 630] CD2550 [Peptoclostridium difficile 630]  ali follow..  31  8MLKKLCSLAMVAIMTTTLITGCSSGNGKDSKKDGEKEK........................................................................... 45
27 -15.200IDP05268 hypothetical protein lmo0366 [Listeria monocytogenes EGD-e] lmo0366 [Listeria monocytogenes EGD-e]  ali follow..  21  1MKK--LIIVMLTIFTAVLVVGCSGTGTADKAETKKETTKESKQANAVKKEVKEMKSNLDDVKKAISDKDKSA......................................... 70
28 -15.200IDP05592 putative lipoprotein [Bacillus anthracis str. Ames] BA_3194 [Bacillus anthracis str. Ames]  ali follow..  15  1MKI--LKFGIIGALSITLLIGCTSNSNETKASNKEASTAVKEKEIVYENVMFEQKEVRKLEISPVNSKSSNQVVNTENIKTIFTSMES-AEKKTLLLDQEAKNYIHSKM.... 106
29 -15.200IDP05674 hypothetical protein lmo0859 [Listeria monocytogenes EGD-e] lmo0859 [Listeria monocytogenes EGD-e]  ali follow..  22  1MKRKIAIAALSVVVAGSLLTACGGGNSKSDDNGKTK............................................................................. 37
30 -15.200IDP05153 oligopeptide ABC transporter, oligopeptide-binding protein [Bacillus anthracis str. Ames] BA_0656 [Bacillus anthracis str. Ames]  ali follow..  17  1MNKPKLYKVLSTLAASTLLSACGGADSGSKKTNTKKVETNKFSAAVKNDGKEIKDGS........................................................ 58
31 -15.000IDP05207 putative sulfonate ABC transporter,solute-binding lipoprotein [Clostridium difficile 630] CD2365 [Peptoclostridium difficile 630]  ali follow..  22  3LSKKIQALILFGVMGTSILTGCSSKPKEKEEAKTGKDDYT......................................................................... 42
32 -14.900IDP05449 hypothetical protein lmo2595 [Listeria monocytogenes EGD-e] lmo2595 [Listeria monocytogenes EGD-e]  ali follow..  19  1MKKRGLLLVSVLMLFIFLTVACGSSEDNEESGEISTKEIELTVDDPIIPTDE............................................................. 52
33 -14.800IDP05708 hypothetical protein lmo2839 [Listeria monocytogenes EGD-e] lmo2839 [Listeria monocytogenes EGD-e]  ali follow..  22  1MKKKSLVLLVVVLVLSAVLAACGGKESGSKEVTIEFMHSSVEKERLDVINKLIADFEKENPTIKIK............................................... 66
34 -14.800IDP05507 putative lipoprotein [Bacillus anthracis str. Ames] BA_5374 [Bacillus anthracis str. Ames]  ali follow..  18  1MRKLGLITALFALLFS-SFTGCDNSPLDKKVKEEAKRTEKEKGPKLTKMSTESFNQSISQG.................................................... 60
35 -14.800IDP91126 extracellular solute-binding protein, putative [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00176 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  16  1MSKI-LKCITLAVVMLLIVTACGPNRSKEDIDKALNKDNSKDKPNQLTMWVDGDKQMAFYKKITDQYTKKTGIKVKLV................................... 77
36 -14.700IDP05266 hypothetical protein lmo0047 [Listeria monocytogenes EGD-e] lmo0047 [Listeria monocytogenes EGD-e]  ali follow..  12  1MYKKLATVGMTVLLVG-ALSACSFNDDKDTSSNNSNNETTSSKSSNNESSSDSLQNKS....................................................... 57
37 -14.600IDP06519 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09962 [Enterococcus faecium DO]  ali follow..  18  1MKKYKLVIALLNITLLFSLSACGKTNEEVTANIADPMIKKATT...................................................................... 44
38 -14.500IDP05242 hypothetical protein lmo2079 [Listeria monocytogenes EGD-e] lmo2079 [Listeria monocytogenes EGD-e]  ali follow..  18  1MKKGILLSILLALVL--VISACGESAEEKAAKTPQGKFVQTMKNGMNVPDQ.............................................................. 49
39 -14.500IDP04329 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1466 [Clostridium perfringens ATCC 13124]  ali follow..  15  4NKKLIALLLGGIIGTSSILAGCGSGGSASSSDGEGEKPVNLVWYVIGKPQNDGELVEEEVNKYIKD---------KINATVDIKHIDFGDYSQKMNVIANSGEEYDL...... 101
40 -14.400IDP06193 gene: lpp20; lipoprotein [Helicobacter pylori J99] NP_224067 [Helicobacter pylori J99]  ali follow..  26  1MKNQVKKILGMSVVAAMVIVGCSHAPKSGISKSNKAYKEATKGAPD................................................................... 46
41 -14.400IDP05625 putative lipoprotein [Clostridium difficile 630] CD1348 [Peptoclostridium difficile 630]  ali follow..  17  1MNK--IAVSFLIIATTLLSTACMDYSISAVELVDSKESAVVKKDEDAKEETTSKMINSKK..................................................... 58
42 -14.300IDP05486 putative lipoprotein [Bacillus anthracis str. Ames] BA_4573 [Bacillus anthracis str. Ames]  ali follow..  12  1M-RAFFRGIGPFLIVVLLLVGCQSEENKIEQKATTTKAEEKVQITKEEEKS.............................................................. 50
43 -14.200IDP02726 maltosaccharide ABC transporter, maltosaccharide-binding protein, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA4229 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  1MKKA-LSLLTVSALSIGMLSACGPKDSGKKEESKAKKDYD......................................................................... 39
44 -14.200IDP91964 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007935 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  10  1MKKTFSKSAVLLTASLAVLAACGSKNTASSPDYKLEGVTFPLQEKKTLKFMTASSPLSPKDPNEKLILQRLEKETGVHIDW------QSDFAEKRNLDISSGDLPDA...... 105
45 -14.200IDP05445 hypothetical protein lmo0821 [Listeria monocytogenes EGD-e] lmo0821 [Listeria monocytogenes EGD-e]  ali follow..  13  1MKKIIFTVVLSLVL---VLAGCADVTNTVKVDKKGEATISFDIDISSVAGIFASSYSDEVEAKLKEAGFTVD......................................... 69
46 -14.100IDP04392 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1500 [Clostridium perfringens ATCC 13124]  ali follow..  23  1MRV--LKGVILAIIPAFLFMGCGEFSKNDVAKVSFEKLSEKEEQ..................................................................... 42
47 -14.100IDP05460 putative lipoprotein [Bacillus anthracis str. Ames] BA_0985 [Bacillus anthracis str. Ames]  ali follow..  12  1MKK--IISICALTALSFTLIGCASTSATDKSPQAKQEHKQNAFQLNSANITDIEILQTTNNTTSKSQTDNKE......................................... 70
48 -14.000IDP04088 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_2931 [Clostridium perfringens ATCC 13124]  ali follow..  13  1MKKGMILLILSSFL----LVGCDSIKMDKLAANNNERVKTIANDLIGDID............................................................... 46
49 -13.900IDP05694 hypothetical protein lmo2007 [Listeria monocytogenes EGD-e] lmo2007 [Listeria monocytogenes EGD-e]  ali follow..  17  1MKKK-WGVIIASLCLLLGLSACGSDEKADANEVPT.............................................................................. 34
50 -13.800IDP04378 extracellular solute-binding protein [Clostridium perfringens ATCC 13124] CPF_2335 [Clostridium perfringens ATCC 13124]  ali follow..  18  4FKKLIALTACAMLTTSVALTGCGADKTANAGEGETVKLTWYTIGQTPKDLDMVQEKANEYLKE------------KINATIDMKFIDYGDYTQKMGVIINSGEPYDL...... 98
51 -13.700IDP05180 putative oligopeptide ABC transporter, oligopeptide-binding protein [Bacillus anthracis str. Ames] BA_3644 [Bacillus anthracis str. Ames]  ali follow..  11  1MKKKFTAVVAPVLAMSVALTACSGSGGEKKSTTTSSGGGEEKKSEIKYAAKQVLNRTENQEIPTMDVSKSTDTLGSQILGNTMEGLYRLDKDNKPIPAAAESSTKSEDGKKY. 115
52 -13.700IDP05607 putative lipoprotein [Bacillus anthracis str. Ames] BA_4862 [Bacillus anthracis str. Ames]  ali follow..  13  5MKFSMFMFLGVVLI---ILAACTTKSVEQVAVKEVPKEGYIILRNETV................................................................. 49
53 -13.700IDP05430 hypothetical protein lmo1265 [Listeria monocytogenes EGD-e] lmo1265 [Listeria monocytogenes EGD-e]  ali follow..  14  1MKNRIT--MIAGIVCLSILTACSSSESVKGTTSEEQTTSQSGAEMIKANNGVVSYHGK....................................................... 56
54 -13.700IDP05515 putative lipoprotein [Clostridium difficile 630] CD1687 [Peptoclostridium difficile 630]  ali follow..  14  5VKKSIS-LMIILTIFIFMLTACEKDEQPDSVDIQTEDKNEIKIDEGNAKV............................................................... 53
55 -13.700IDP05448 hypothetical protein lmo2594 [Listeria monocytogenes EGD-e] lmo2594 [Listeria monocytogenes EGD-e]  ali follow..  14  1MKKTSIIFIFCTLL---FVTACSTSENQTQATEATGTIEQVETDA.................................................................... 42
56 -13.600IDP05433 hypothetical protein lmo1730 [Listeria monocytogenes EGD-e] lmo1730 [Listeria monocytogenes EGD-e]  ali follow..  22  1MKKKMFVVLALVLSLSLVLMACGGSKDDANSGDSKV............................................................................. 36
57 -13.600IDP05622 ABC transporter, substrate-binding lipoprotein [Clostridium difficile 630] CD0999 [Peptoclostridium difficile 630]  ali follow..  23  1MKKY-ISIILLVVLTMVVLVGCSPGKDNPKNKELSVVKQ.......................................................................... 38
58 -13.400IDP06546 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09092 [Enterococcus faecium DO]  ali follow..  12  1MNRKLIAGVVCLAAASGFLTGCGSASSTADKEEKVTVWAWDETFNIKAVNEAKKVYENEETEIEVVTMSQDDIVQKLNTAL................................ 82
59 -13.400IDP04017 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1035 [Clostridium perfringens ATCC 13124]  ali follow..  19  1M-RKLVSLLLSIGILSGAFIGCGRNNQKEVSDNENSSNISNEEKNNKEVKNDNNDKKESKDSENDTKDNKDK......................................... 71
60 -13.300IDP05050 iron compound ABC transporter, iron compound-binding protein [Bacillus anthracis str. Ames] BA_5330 [Bacillus anthracis str. Ames]  ali follow..  15  1MLLKLVSILAIFTL---MLVACSDSGKETSKATKDNSSDKPKTVEITDAHGKVK........................................................... 51
61 -13.300IDP05387 putative oligopeptide ABC transporter, oligopeptide-binding protein [Bacillus anthracis str. Ames] BA_2041 [Bacillus anthracis str. Ames]  ali follow..  10  1MKRKVTTIAAVALSTSVLVAGCGNGEKASTTKKEAGKGAADKQVLNLLETAEIPSMDTSKSTDSVS............................................... 66
62 -13.300IDP00820 iron compound ABC transporter, iron compound-binding protein SACOL2167 [Staphylococcus aureus subsp. aureus COL]  ali follow..  20  1MRGLKTFSILGLIVALLLVAACGNTDNSSKKESSTKDTISVKDENGTVK................................................................ 49
63 -13.200IDP04377 putative maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein [Clostridium perfringens ATCC 13124] CPF_2652 [Clostridium perfringens ATCC 13124]  ali follow..  21  1MGKRLATVMAATMLFAGSLVGCGGKSDSGSADGSGKE............................................................................ 40
64 -13.200IDP06508 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN10305 [Enterococcus faecium DO]  ali follow..  16  1MKGKKWLIGSLLVAATGILGACGGGSSAESDSDKEVT............................................................................ 37
65 -13.200IDP05600 putative oligopeptide ABC transporter, oligopeptide-binding protein [Bacillus anthracis str. Ames] BA_3645 [Bacillus anthracis str. Ames]  ali follow..  10  1MKKLTAVVAPVLAMSM-ALTACSTSGGDKKTSTNSSSGGDSKSEEKLAAKQVFNKTENQEIPTMDTSKSTDTLGSQILGNTME.............................. 82
66 -13.200IDP05451 putative lipoprotein [Bacillus anthracis str. Ames] BA_0580 [Bacillus anthracis str. Ames]  ali follow..  22  1MKKIGTMLLFSI-----LIAGCTQAQPDLKKPKKEAIATSSTQVNAPSFFHLSVLKDVN...................................................... 54
67 -13.100IDP05398 putative phosphonate ABC transporter, phosphonate-binding protein [Bacillus anthracis str. Ames] BA_3750 [Bacillus anthracis str. Ames]  ali follow..  20  1MLKKFFAMSTTVVLAAGLLSGCGTKESSANKNADTKKGYVPKT...................................................................... 43
68 -13.100IDP04565 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1805 [Clostridium perfringens ATCC 13124]  ali follow..  18  1MIKKIVVAVGLAFSLS-FLVGCGNKSEQGKAAIKQGNYEEATAIFKAASEEDSKDKEE....................................................... 59
69 -13.100IDP05579 amino acid ABC transporter, amino acid-binding protein [Bacillus anthracis str. Ames] BA_0855 [Bacillus anthracis str. Ames]  ali follow..  20  2..KKLFSVLAVTTLAIGIVAGCGKEEKKDTASQDALQKIKQSGELVIGTEGT............................................................. 51
70 -13.000IDP06507 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN11122 [Enterococcus faecium DO]  ali follow..  23  1MKKNSRIVMMGVALVSGLLAGCGNGSASNSDKVE............................................................................... 35
71 -13.000IDP05150 putative oligopeptide ABC transporter, oligopeptide-binding protein [Bacillus anthracis str. Ames] BA_0195 [Bacillus anthracis str. Ames]  ali follow..  13  1MKKKFVPGIASVVGVSILLTGCGSYKNEASGANAKDEAPSKQVLNLSSPTEIRTMDTARATDTDS................................................ 65
72 -12.900IDP05366 putative substrate-binding family protein [Bacillus anthracis str. Ames] BA_2255 [Bacillus anthracis str. Ames]  ali follow..  12  1MTRTKNMLIFCIMLLTIIIAGCSKEEKKENDTSAKAKDSYTIKHAMGETT............................................................... 50
73 -12.900IDP91971 lipoprotein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100002131 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  27  1MNKKQWLGLGLVAVAAVGLAACGNRSSRNAASSSDVK............................................................................ 37
74 -12.900IDP05149 putative oligopeptide ABC transporter, oligopeptide-binding protein [Bacillus anthracis str. Ames] BA_0194 [Bacillus anthracis str. Ames]  ali follow..  20  1MKKKVVPVVASVLGASLLLTACGGNKDNASGAKANDKAPDKQAINLSFASEIPTMDVAKATDGES................................................ 65
75 -12.900IDP05599 putative oligopeptide ABC transporter, oligopeptide-binding protein [Bacillus anthracis str. Ames] BA_3642 [Bacillus anthracis str. Ames]  ali follow..  20  1MKKKFTAVVAPVLAMSMALTACSGSSGGEKKSTTTSNNGGEEKKSDIKYAAKQV........................................................... 57

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.