current user: public

If you have questions about the server, please let us know.

Query: IDP05525 putative sugar transporter, substrate-binding lipoprotein [Clostridium difficile 630] CD2550 [Peptoclostridium difficile 630], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MEGIKVGMLKKLCSLAMVAIMTTTLITGCSSGNGKDSKKDGEKEKLVLWMPPVENNMKEVWDPILDKFEEKNNCEVDLQIIPWDNYSEKFATAISAGEGPDVGYMYAEMYPQFIESGAVEDLTNYATKEDKEQSIYIKTSEMMGGMYGMPFQAANPGVLYYNKDILEKLGEKPPKTWEDFKRICKKATQDTDGDGKIDQWGLAQGWGAKTFGNLNWNWYPYLWQAGGDIFNDDLKSVKFNDKSGLEAAKFLKELQAYVPEDSLSKDSNEMIESVFGPGKAAFTIMLSSAATSVFDESFPDLNWGFVTGLEDKKAATFGAVDHLSLMSSAKNKELAYKLIQHMLSVESMTEFHKAIPRAPITKGEPYQGDERFKEMVENDKNVYRPLVVGPHGVEIYEYLWKELQTMISGDKTPKQALDDAAKYSNDLLAQLast
1 -122.000IDP05525 putative sugar transporter, substrate-binding lipoprotein [Clostridium difficile 630] CD2550 [Peptoclostridium difficile 630]  ali  100  1MEGIKVGMLKKLCSLAMVAIMTTTLITGCSSGNGKDSKKDGEKEKLVLWMPPVENNMKEVWDPILDKFEEKNNCEVDLQIIPWDNYSEKFATAISAGEGPDVGYMYAEMYPQFIESGAVEDLTNYATKEDKEQSIYIKTSEMMGGMYGMPFQAANPGVLYYNKDILEKLGEKPPKTWEDFKRICKKATQDTDGDGKIDQWGLAQGWGAKTFGNLNWNWYPYLWQAGGDIFNDDLKSVKFNDKSGLEAAKFLKELQAYVPEDSLSKDSNEMIESVFGPGKAAFTIMLSSAATSVFDESFPDLNWGFVTGLEDKKAATFGAVDHLSLMSSAKNKELAYKLIQHMLSVESMTEFHKAIPRAPITKGEPYQGDERFKEMVENDKNVYRPLVVGPHGVEIYEYLWKELQTMISGDKTPKQALDDAAKYSNDLLAQ 430
2 -91.500IDP05433 hypothetical protein lmo1730 [Listeria monocytogenes EGD-e] lmo1730 [Listeria monocytogenes EGD-e]  ali follow..  20  1.......MKKKMFVVLALVLSLSLVLMACGGSKDDAN--SGDSKVLNVWAM---GDEAKSLKELAQKFTKDTGIEVKVQVIPWANAHDKLLTAVASKSGPDVVQMGTTWMPEFVEAGALLDITKDVEKSDLFFPGSVKTTQFDGKTYGVPWYA-ETRVLFYRTDLLKKVGYNAPKTWDELSDAALKLSKRGK-----DMYGFAIDPNEQ------TTGFIFGRQNGSPLFDKDG-TPVFNKKPFVDTVTYLDSFIKNGSAPD-TDLGLDASQSFGGDGIVPMFMSGPWMVNTLKDTAPDDGKWATAVLPKKENNESSLGGANLSIFKYSDKKDDALKFMDYMSQPDVQLSWLKDTNSMPARMDAWEDKNDPYYKVFGEQMKTAEPMPLIPQFEEIAQLYGKSWEQIYRGGADVQTQMDTFNDQVETLLKK 414
3 -90.100IDP95187 gene: lmo0181; lmo0181 [Listeria monocytogenes EGD-e] CAC98396 [Listeria monocytogenes EGD-e]  ali follow..  23  1........MKKGLLLLMVVVLSVFGLSACGGGSS-----SGDKTEITYYQF-SAPADGKALDEMVKEFEKQNDIKVNVQTIAFNDYFTKLQTQIAGGDAPDAFELNYETFMQYAEKGVLADLTSYIEKDSTLNKQAYDAFKYDGKQYGMVESF-SNVVTIYNKDLFDKAGVEYPWTWKDEEAAAKKLTDAKNK-----VWGTSQPVT-------MNEFYKVAAQNGGSIFNEDLTETTINSPENVEALTHLTNEVTDSKVAPSPADSGQLPEDLFMNGQIAMLHTGIWLFDMFQDA---PFKWDVQVEAGNTQKATHFFANGIGVSKDSDKKEAAFKFASFMSANEEAAKIRIDNNELPATENKEILQPPDNREAVFESLQYMVLPPVVKDWNKISDYTNSEFEKVLNGDSTPEKALKNSEDNINKTMGF 417
4 -89.900IDP05444 hypothetical protein lmo0768 [Listeria monocytogenes EGD-e] lmo0768 [Listeria monocytogenes EGD-e]  ali follow..  20  1........MKKVLLAILSMVLLLS-LAACGGSSDSSKDKNG-KEEIVMWGSW-SGDQIKQLEKQIDSYNKSQD-KYKVKYVMQENVEEKLLTGIAGGELPDIIMWDRYQTALYAPKGVLEPLDKLVKEDDDFYEESVKEMTYSDKLYGLPLLN-DNRILFYNKKLLQEAGVKPPTTWDELATAAQKTTKWDG--NKMTQAGMSL--------QDVGLFNLYLMQAGGELVTSDNKETAFNSEQGLEVLNYWDKMQNDLKVYQ---RGFDDGSDAFAAGKEAMTYNGPWALADYNKV--EDLDYGVVEPPKNGDKGAIMGGFGLVMPKQAEHKDGAWDFMKWWTTPENGVEFAKISGWLPANKIAAEDTKDPNYSVFVNTMKYAKIRPTVAGYADVEGAMKPQFEKFMNGNISAEKALSQAEKEGNQILKE 413
5 -88.600IDP91953 extracellular solute-binding lipoprotein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100002215 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  18  1.......MKFRKLACTVLASAAVLGLAACGNSGGSKSGGDGAKTEITWWAFPTGDGVGTYEKSIIEAFEKANDVKVKLETIDFKSGPEKITTAIEAGTAPDVLFDAPGRIIQYGKNGKLAELNDLFTDDDVNNENIVQASKAGDKAYMYPIS-SAPFYMAMNKKMLEDAGVAEGWTTDDFEKVLKALKDKGYTPGSLFSSG---------QGGDQGTRAFISNLYSGSVTDEKVSKYTTDDPKFVKGLEKATGWIKDNLLNNGSQFDGGADIQNFANGQTSYTILWAPAQNGIQAKEASKVEVVEVPFPSDEGKEYLVNGFAVFNNKDDKKVAASKKFIQFIADKEWGPKDVVRTGAFPVRTSFGKLYDDKRMETISSWTQYYSPYNTIDGFAEMRTLWFPMLQSVSNGDEKPADALKAFTEKANETIKK 438
6 -87.800IDP05761 hypothetical protein lmo2125 [Listeria monocytogenes EGD-e] lmo2125 [Listeria monocytogenes EGD-e]  ali follow..  20  1MKRF------KKVGIVSAVLVMALSLAACGGGKDTSKSGSSDEKTLTVSV---DAGYKDYVNKIKGDFEKDNDVKVKVVEKDMFETLEALPLDGPAGTAPDVMMSAFDRIGSLGQQGHLAEVKLGNK--DDYDEKDQKQVTIDDKIYGAPAII-ETLVLYYNKDLLDKA----PATFKDLETLSKDSRFA-FTSEKGKNTGFLAKWTD------FYFSYGLLAGYGGYVFGDEGKDIGLNNKGSVEGITYATKWFQDVWPKGMNKSADDFIQDQFVKGKAAAILGGPWSAANYKEA---KINYGVAKIPTGKEYSPFAGGKGWVVSNYSKNKDVAQKWLDYVTNQKNQETLYDMTNEVPANLKARDTKNDELTNAVIEQYKNAQPMPNIPEMSEVWTGAENLMFDAASGSKTPQQSADDAVKVIEDNVTQ 415
7 -86.700IDP06508 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN10305 [Enterococcus faecium DO]  ali follow..  18  1.......MKGKKWLIGSLLVAATGILGACGGGSSAES-DSDKEVTLTFWNGF-TASDGEILQEIVNEFNKTNNIKIEMDIMTWANLNEKLPTAISSKKAPDFIALNYPDFAQYVENGAVQPLDDFWEYDSDFKETAIELGEVEGKQYFVPMQV-QGMYMYWNNDLFKQAGLDTPTTWEELTEMAPKLTDSSKN-----VSGFVFNKDG------TAPLYNWMLANGGKLVNDDYTKSEFASPENLKTLKAIQKMIHVDKTGPESI-SGAEMDNLMNAGQLAIEINGPWLNNGLKAN---EIDYNVTTLPQSDKKTAILDGVGYAIPASTDKKEAVYEFLKYWNTTEIGKKWSIENGFPAYLDSVAVKNDPIVSELSKQMDYAEPYLPGFTQISAINNDIINPLIEKLLAGEDPETLMNDADDAINQLLQK 423
8 -86.500IDP02726 maltosaccharide ABC transporter, maltosaccharide-binding protein, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA4229 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  18  1........MKKALSLLTVSALSIGMLSACGPKDSGKKEESKKDYDLLVWE---DDKKGVGLEPAVKSFEEKYKVKVKVVEMQMTDQVKKLRLDGPAGTGPDVVTLPHDQIGNAVTEGLLSEVKADDAVKSKFTDSSIEAQTYNGKLYGLPKAI-ETPVFIYNKKLMPKA----PETMDELFNFSKEFTKD-------GKYGFLALGDN------FYFANAFMAGMGGYVFGENASDVGLNNSGAVQGAEYLQKWYKEKLFPKIGESGGPAADGLFNEGKAASIMNGPWAFQAMEKN---GIDYGVAPMPKGQPLKTFVGVKGWHVTSFSKQNDLATKFTEWVTNEENAKIRFEKTKEIPPVKAVMEDKDNEAAKAVATQSENGIPMPNIPEMQEVWKPAGDALQLVVTDKEAPKAALDSAVKQIKGNIEA 413
9 -85.400IDP91126 extracellular solute-binding protein, putative [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00176 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  16  1........MSKILKCITLAVVMLLIVTACGPNRSNKDNSKDKPNQLTMWV--DGDKQMAFYKKITDQYTKKTGIKVKLVNIGQNDQLENISLDAPAGKGPDIFFLAHDNTGSAYLQGLAAEIKLSKDELKGFNKQALKAMNYDNKQLALPAIV-ETTALFYNKKLVKNA----PQTLEEVEANAAKLTDSKKK-----QYGMLFDAKN------FYFNYPFLFGNDDYIFKKNGHQLGLNSKHVVKNAERLQKWYDKGYLPKAA--THDVMIGLFKEGKVGQFVTGPWNINEYQETFGKDLGVTTLPTDGGKPMKPFLGVRGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTDEMSEITGRVDVK--SSNPNLKVFEKQARHAEPMPNIPEMRQVWEPMGNASIFISNGK-NPKQALDEATNDITQNIKI 412
10 -85.300IDP02597 putative sugar binding protein [Yersinia pestis CO92] YPO3472 [Yersinia pestis CO92]  ali follow..  21  1........MKTQMIMSKVKIKSLLLLTYLAMGIPS----LHAAETLQVWIR-ASNDSKNIYKKEADTFEKKTGIKIEYFNAT-TDFEQRLARAAAGNALPDLIFNDAVAIGQFVQLGIVEPIEPKNIIGNIFDTAWKSTQYIDGKYYGVPTS-AQTFALFVRKDWREKLGLEQPKNWQDISTLAKAFTNDPDGNGKNDTYGFILP-GSTTRGYASWFISSYLWQAGGDFIRPAGEIASLEEPAATETLSFMRGMVCDKTVQPAINATTADAIPSFRSGQSGMFFSGPYHIALF-DKDPGTEAFEVIPPPTGPKQATLAEGTTVFMMKSSQKKAAAQKFIEFMISPEGQQGMGMGTKNMPVVRLSIVYDDPRWAIFADLYAEQGRYIPQVPNWTPIRQVTAEGFNRILANDSDIAAELKAVNQKVNDELAK 431
11 -84.600IDP05708 hypothetical protein lmo2839 [Listeria monocytogenes EGD-e] lmo2839 [Listeria monocytogenes EGD-e]  ali follow..  16  1.......MKKKSLVLLVVVLVLSAVLAACGGKES-----GSKEVTIEFMHSSVEKERLDVINKLIADFEKENTIKIKQIPVEEDAFNTKVVTLARSGKLPAVMEVSQDFA-KVMDKDELIDQDAVKEGEDKYYEGATNLVRSEKSYIAAPLS-GWVQGIWYNKKALADAGFEEPKNWADIEKVAKKFTNKADK-----KYGIAIPTAESTMSE--QAFSQFALSNKANVLDAKG-NVTIDTPEMKEALQYYKDLSAYTMPGS---NDVTEIKDAFMNGTVPMAMYSTYILPSVYEEG-DPKNIGFAIPEKEKAVYGTVSGLTISAGLDDEQKKATKKFVEYLSQPENMATWVLMSGAQPVNKEVVEQKENEVIKSFGDLPNEIAASFNDIQVFTSSGIIAQMVNNVTVGGGDVSADLKAAQKKAEEG... 429
12 -84.400IDP06544 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09718 [Enterococcus faecium DO]  ali follow..  16  1........MKKII-VTTCLLATGFLLTACGESQSSNE---SQQTTIQFMHSSVEQERLSVINELVADFEKENDIKIKQVPVEESAFNTKIVTLARSGKLPEVMEVSQDFAKVMDKDELIDQTAVQNVIEDNYYDGAKNLVRSEKSYIAAPIS-GWVQGIWYDKEKLSEAGFSEPENWDDILKIAQHFTDKENK-----QYGIAMP--TAEGTMSEQAFSQFALSNGANVLDDEG-EVTIDTEKMREALSFYQNLSQYTMPGS---NDVTEIKDAFMNGTAPMAIYSTYILPSVYEAGNSENIGFAIPTQKDQAVYGTVSGLTISSGLDEKQKEAAEAFTAFLSQPKNMEKWVLMSGAQPVNKQVVYKENEVIKSFGELPSEIASGEKNFTKMGDISGVIGKAVNQVTVGNEDVDQALADAQKNTK..... 427
13 -83.400IDP92716 sugar ABC transporter substrate-binding protein [Streptococcus pneumoniae D39] YP_817037 [Streptococcus pneumoniae D39]  ali follow..  19  1........MRKGTMLSVVAGLSLAILAGCSGGTNSKQ--ASSSNDIKVWVQSDETNEGKAWQKVVDNFNQSGKYKVVTEYIPRGGYEDKVNAAITTNSLPDVITLDGPNTAAYAKSKVITPLDDYLKDNDDVLDSIKQQGTYNGKFYAFGFS-ESNVGVYYNKKMFKEAGIAEPWTWDEFNTIAKKLKDHYNKPTIDFRIN-------SNDEMLPYAYMPLIWSNNGSVVNEDGTKAEFNSKESVEAVQFIQNLVKEGYTTV------SPVEKGFETGEYPMLLSGSWTIADM-NTNYKDIDFGILPYPKTKKLVSPSGSWQLAVTTKSDKKEAASEFVKFATNTESSEIISLGNSVLPIRKSTIDKVSEPMRFLMEQNSKTAHARPVVVAYPQVSRAFQQAMQDISYYEENPQKVLDTRTKEMQTAIDQ 433
14 -82.300IDP05674 hypothetical protein lmo0859 [Listeria monocytogenes EGD-e] lmo0859 [Listeria monocytogenes EGD-e]  ali follow..  16  1MK------IRKIAIAALSVVVAGSLLTACGGGNSKSD--DNGKTKVTFWAA-PNPTQVKYWDEMAKAYEKENDVTIEVSQMKEPSSEATIQSAIASKTAPTMSEINRSFAAQLADSKAIVPLNDVKGLDDNMSETMDSWKFSDGNQYVLPVY-SNPILFAWRLDTLKELGYDPPKTYSEALEVGKKLKAKYPDK----LWAKGDLSDPTAWMRWFDFFPLYDAASKGNAFVEDG-KLVADDKAGTELLTFMSELQKNKLLLA------SKATDPFETGTSIMADNGPWTFPNWDEKFPENYAITAPLVPNEENVATYADSKGVVMYATDKEKEAAMDFLKFVYNDDKNDKFLETTNLIPARDDATFFKENPELEVYAANVPYSIPAMDDAKYNDIQQIIEEAWNPIVRGEKKPTKAWSDMKKAEDGVLQE 439
15 -81.500IDP01500 gene: malE; maltose ABC transporter periplasmic protein VCA0945 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  1MVSPTTQKEKDMNMKNALSTVALSTLVALGSFGAHAA---IEEGQLTIWI-----NGDKGYNGLAEVGKKFEDTGIKVTVAHPDALQDKFPQTAATGDGPDIVFWAHDRFGGYAEAGLLVEIKPSAKIQEGIVDFAWDAVKYNGKIIGYPIAV-ESLSLIYNKDLVPN----PPKSWEEVAELDAKLKKE-------GKSAIMWNLKEP------YFTWPLMAADGGYAFKYDVKDAGINNKGVKDAMNFVKGLVDKGVISPDM--DYSVSESAFNQGNTAMTINGPWSWGNIEKS---GINYGVTTLPKGQASKPFVGVLTAGISTASPNKDLAVEFIENYLLTNDGLRMVNNDKPLGAVALNSFQDADARIAATMDNAMNGEIMPNIPQMNAFWSSAKNAIINIVDGRQTVDAALADAEKQMTK.... 406
16 -81.000IDP04377 putative maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein [Clostridium perfringens ATCC 13124] CPF_2652 [Clostridium perfringens ATCC 13124]  ali follow..  17  1MG----KRTKILATVMAATMLFAGSLVGCGGKSDSGS-ADGSGKELTVWSH-LTTPEVEELNKMASKWGEENGVKVKV--VEDKSEMQAYIQAANSSKGPDIMFLAHDNLGTFQKAGLLAEVPEGIINDDYASHQVLDAVTIDGKRYAVPIAQ-ETSALFYNKDKVKEV----PKTMEDLVKVAEEGA------------------GFKYDINNFYATYGFIAADGGYVYKDNNTDIGLGTPGAIKGYQFVQDLVQKDKLMP-ADITGDIAKGDFLSKNTGFYISGPWDVSAFKDG---GVNFGVAPMPTGKQVPTFLGVQTAFVSEKSQNKDLAWKLVKYLSENSGDVLLNK-GNRIPVLNKYLDSKNNEYMSAFAEQAKFATPMPNIPEIQAMWGPAGANLQLLTSGQVTPEKCAEMTVEQIKQGIAQ 406
17 -79.300IDP02207 putative sugar binding protein [Yersinia pestis CO92] YPO0612 [Yersinia pestis CO92]  ali follow..  14  1.................MKILYYIAIAIASLPLMA-------AERLEIMVP-SGSYVSFMRNTVTPEFNKLYEVNLVVS------NDEQLDTRMAAGDNPNVYIGVFGYPAKLAKLGKLAYLDKFPGFAERIDPHFLR--ENFGRTYYIPWN-ATTQMMIYNKELFAEAGLDPPATWDEFLLAAEKISALPPRSDGSKVYGTVFWNDVLSFGSWYWNMYYNVNQGQYQLLNRYGTDIVFDRPD-ANMAQFMRTMQQAQRFAP------LTMEKSFFSRNIGMWLQFGFGWKATLSSAAEGQDVAIAPIPKGDIHYSVLDGRAIMIFKDARKEQLSWALLNLLMRDDINLQANIALGQLPTLKALQDAPQSAEAQPFVQQLQHAILSEPFANAMEVANIIANYSKVVLKGEISPEQAVATSAQAARQLLNE 413
18 -75.900IDP06507 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN11122 [Enterococcus faecium DO]  ali follow..  13  1MKK------NSRIVMMGVALVSGLVLAGCGNGSAS----NSDKVELSINYY-----NGAISKKAMDNAKKEFDYKLSFKQIPADDFDTKLKASLNSKSAPDITAINSNISDYLPYADKFVNLLDYDSETADFVEWKWDSCFTNDKQIAMPIDI-GPTALFYNVDAFAKAGLPTNKDEESLMAAAKQMKEKADMPFFQSSLSL---------------LQSKNRTMTEHIYDENG-KLTYANGQLKEIWDYAVKAEKSGYTLGTKGNSAD--ANSVQKGMFGGMIEASWGINDLAENGVSPKQWMIAKSPFT---ASNYGGSYLAVIKTSSHPKEAAEVVKYLTNEDSQRANYEELALFPSNTKVYLFGDEEFNHYFIDAANELEYVPSDPRESAAFKCFEDQIILVAEQGKDPEKAWNDAVKKVEEMSK. 417
19 -75.800IDP01422 glycerol-3-phosphate ABC transporter, periplasmic glycerol-3-phosphate-binding protein VC1549 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  1........MNK--------VWLTGLLTATASGVFSAS--TLAATEITWWHAM-GGQLGETVNQLATDFNASQDYKLTPVYKSYTETLTAGIAAFRAGQAPNILQVFDAGAATISSKGVAKPVQDLMIESQDYIAGVRNFADNTGKMVGMPFN-SSTPVLYYNKDMLASVNAQAPQTYEQLEQVAAKLAEKGQA-------GFAQSLTPWIMFENFKSRHNLPLSDKQNGYQDLSTKIMFNSDDMLMHVKKLKEWSDKGYYKYYGSDWDA-NQTPFERGEVAMWMGSSGSFGGLRNRV--KFNLGTTYLPTKNPTHTFIGGAALFALQGHAQDKGVAAFFAYLTKPETQMNWHKTTGYVPVTNAAYYQENPDAEVGVKQPDGEWTKGYRLGYYPQVREVMHREFDNIFSGRSTVESSLNKVEDESAKLLNR 428
20 -75.700IDP06546 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09092 [Enterococcus faecium DO]  ali follow..  14  1MN------IRKLIAGVVCLAAASGFLTGCGSASST----ADKEEKVTVWAW-DETFNIKAVNEAKKVYENEE-TEIEVVTMSQDDIVQKLNTALASGNLPNIVLIEDYRIQGYLTSDAFANLSAIVKE-DHFAPYKFAVNKVGDKIYGVPFDS-GVTANFYRTDLMAEAGYTEELKWDEYIQVARDVKEKTGKK-------------AEVNPSDLGRVRMIMQQAGEWYTSEDGETVTQDNASLKYGLELFATLLKEDLVEQTS--DWNAGVTAIQSGAVASSPTGAWYSSTIQGAENQSGKWKIAPIPAQKAQASNLGGAGWYVIKGVAGEDSAKDFLEAASNEELMGTLAKEIGLVSTMLSANFYSGQKIFDDFSTWTSEIPEVNYGHETYAIEAVVAEALHRIINGE-ETDKVLADTQKQVEAQLAN 428
21 -72.100IDP04242 sugar ABC transporter, sugar-binding protein [Clostridium perfringens ATCC 13124] CPF_1113 [Clostridium perfringens ATCC 13124]  ali follow..  18  1.......MRKKILSAILCMMIGATAMVGCGDKTDSTQAKDGGKVKLRMTNW----NNEDTMKDMLKYLSEKLNVEIEYQFIDNSNYNTIVDTQLSAEEGPDIICESPASALKHAKLGYLENVNDLA---KKYSDSGTNVYKYDNNVYALPGI-SWFEGIYYNEKLFEENNIQIPKTFDEYIEVCKKFQSL----------GIKLAAGLKSWEPLLKNSMAFVTAAGKNFGQEYREGKVKLDGTWNMYLDKWSEMIKDG-TKDMTGIDHDQALEEFATGKAAMYCSGPWDLEAIMSKN-PDLKLNMMPFYPSDGWLIGGPGCGFAVNSKSKNKDAAMEVLKAISTEEGQKALWENNQGGSSYLTGTSFTLPEAFKGAEKAINAGHIYCPWNEWGSAHVDYGKQMQNYLLGNQDLKTTLSNVDSAASELINK 419
22 -68.600IDP04058 ABC transporter, solute-binding protein [Clostridium perfringens ATCC 13124] CPF_0556 [Clostridium perfringens ATCC 13124]  ali follow..  17  1MK----RKLVKMLTVACVTAIAASAFVGCGNKEEAPKDNEGEKKVLEIAVF-EGGFGKDYWDACIDAFEAEHDVEVKMEANP--KIGDIIRPKLSSENTPDFIYLSTGIANALIKDKALVDLSDVFDREPGFLDTPLTTPYGDGKVFLAPLYY-NVTGMWYNKALFKEKGWEVPKTWDEFFELGKKAKDE----------GIAYTYQGQAPGYNEAVIFPMLASAAGEEAVEKYEEGAWKDPNVKKALDVFQRMADEDMLNGTVGMTHTQAQVEFLNGKALFLPCGSWLEGEMKDAIPEGFEFGFMAPPEGDTPYVTTTIEQMYIPAKSDQVELAKEFLAFQYTDAMVQKNAEIAKAVVPVKGAVEKAKSSLDASGYESYKFVEEGAKPIPLDFRNDSLFGPVGSIINKELTVDEWINNLESDSQTLAKE 458
23 -67.200IDP06519 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09962 [Enterococcus faecium DO]  ali follow..  12  2.......KKRYKLVIALLNITLLFSLSACGKTNEEVTANIAKATTLEVYVA--NGKLTNYVENAAKIYNRKANIDLKIVNVASGTTVQMITPKLVTHDMPDIISMADTSAAGVLEKDAFYSADEYGFYDKDQKLNILRQQTSNETIIPWASDF-TPALCYYQPKKFAEIGVDFISSWEEYIQVAKALKEKTGSFG------------ALPESGDQELFINMLAQQNQSLLDEEG-NIRLNTKEAKHAAKLIKEMIDSDIVHF-----YGAQDAEKAFQESAMFVAGGWYATNMSLNFPDSDKWRMAPLIENPGKGAVSGGSSFYVPKDAKNPQVAQQFLTFMLTDEECLANALELGVATSNSLAYQTEA............................................................. 367
24 -47.400IDP92625 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19F] SpneCMD_010100009638 [Streptococcus pneumoniae str. Canada MDR_19F]  ali follow..  13  1.....MKNWKKYAFASASVVALAAGLAACGNLTGNSAADSGDKPVIKMYQIGDKPDNLDLLANANKIIEEKVGAKLDIQYLGWGDYGKKMSVITSSGENYDIAFADN--YIVNAQKGAYADLTELYKKYKALDPAYIKGNTVNGKIYAVPVNVASSQNFAFNGTLLAKYGIDISTSYETLEPVLKQIKEKADVVPFAIGKVFIPSDNFDYPVANGLPFVIDLEGDTTKVVN------RYEVPRFKEHLKTLHKFYEAGYIPKDVATSDTSFDLQQDTWFVREETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQTTQVANFVISNNSKNKEKSMEILNLLNTNPELLNGLVYG---NWILYINENVTDQQIENSKKELAEAKESPVKSEISAIANTMQQFDTAINTGTVDPDKAIPELMEKLKSE... 469
25 -46.100IDP05694 hypothetical protein lmo2007 [Listeria monocytogenes EGD-e] lmo2007 [Listeria monocytogenes EGD-e]  ali follow..  13  1........MKKKWGVIIASLCLLLGLSACGSDEKADA---NEVPTLKWYMIGTPQKDTEVMKEVNKYTEEKIGVKVEMTQIDWGDYGKRMQTVINSGENFDIAYSAAGEFVSYSQKGAFLPLNKYLDKKAELNDVLWEGATIDGNIYGVPSEVGEQQVYVFNKNLVDKYKMDVTKNFSDLEPMLKTIKENEP-----SITPIGGNKDFKPAFPYDYLIDNAVPLPFAVNQYEDTGKIVYEQPETLDILKSLHSFYQKGYVTKDIATSTD--PWSYDKENWFVRIEKYQPYAENIWDKNTGGKYKVVTQPIAETPNNSVTGAIQAVSVTSQHPEEAVKFLDLLNTDEYLRNLVDKG---HFILKLYEDEPADKWDQFKEFNKKSVASPVRTEIASITNVCNEFAPALLTGTVDPVEYTEKFKAKMKKVMKE 472
26 -44.100IDP04378 extracellular solute-binding protein [Clostridium perfringens ATCC 13124] CPF_2335 [Clostridium perfringens ATCC 13124]  ali follow..  12  2.....LKFKKLIALTACAMLTTSVALTGCGADKTANA-GEGETVKLTWYTIGQTPKDLDVQEKANEYLKEKINATIDMKFIDYGDYTQKMGVIINSGEPYDLAFTCSNPYLENARKGAFLEIDELLETKSVIDERFWEGAKIDGKTYAVPNEIGVAPMWVFTKEYVDKYNIPYQHTLEDLEPWLKVIHENEDVTPLYITKGFSAP-----------AYFDQLVDPVGVEYGDESLKIKFETDKMKSELETLQKYYDAGYINASATAKDDKAVKRFVTKADGQPYADG------LWSKDLGYEVVSSPIMDTHITNGSTTGSMIAISKTSEHPEKAMEFLNLLNTDVYLRNLLNYG---LFITYTLDNEPVDKWKEFEAFNDASVESPVSNQIAAINNVLEEFKATIYSGSVNEAEYLDKMNKKIDEVISE 468
27 -43.100IDP04329 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1466 [Clostridium perfringens ATCC 13124]  ali follow..  13  2.....LKNKKLIALLLGGIIGTSSILAGCGSGGSASSSDGEGEKPVNLVWYVIGKPQNDVEEEVNKYIKDKINATVDIKHIDFGDYSQKMNVIANSGEEYDLAFTCSFPYLDNARKGAFLELNDLIDSKNVIDERLWKGAEVDGNIYAVPNEIAGAPMWVFDKELVEKYDIPYIHSVDDLEPWLALIKEKEPD---------FVPFYTQGDGIPIEGIEDITSGLGIFYDDKSLTKNMYETEELKHLFTKLREFYEKGYINQAAVSNMKNEVKRFVWKADGQPYA------ENGWSQSLGREVVTSSIVSSYVTNASTTGAMTAISATSKHPEKAMELINLVNKDEGTHYEKVSDNQIKRDPNGPYSDPVDKWDAFEEFNQKAKTSTVVTQMSAVSNAFEEFIKPLYTGSVDTEETLEKLNKKLYDS... 462
28 -42.400IDP04240 extracellular solute-binding protein [Clostridium perfringens ATCC 13124] CPF_1077 [Clostridium perfringens ATCC 13124]  ali follow..  14  2.....IKRKKALSLILSGIVCSSLILTGCGNSKEEESK---ETVNLTWYVIGDEPADNDVEEEVNKYLKDKINATVDIKHIPFGDYTKKMSVISNSGEPYDLAFTCSFPYLEYARKGAFLELNDLLDTKKEINKELWKGAEIDGKIYAVPNEIALAPMWVFDKELVEKYNIPYIHSVNDLEPWLKLVKEKEPDFIPFY----------TQGDSIPLDFDDIVNPLGIFYNDKNLTTNKFESKEMKDMLLKLREYYEAGYINQAAVTDMKPEVKRFVWKADGQPYA------ENIWGKSLGREVVTSSIIPPYITNNSTTGAMTAISANSKHPKKAMELLTLVNTDTNLRNLLMFG---LLGTYVSENDPIDKWEAFEKFNNSAKVSPVSNQISAINNVLQEFERALYTGSIDPEVGLNDLNKKINEVKDE 464
29 -41.400IDP91964 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007935 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  16  1MK------FKTFSKSAVLLTASLAVLAACGSKNTASSPDYKEKKTLKFMTASSPLSPKDPNELILQRLEKETGVHIDWTNYQ-SDFAEKRNLDISSGDLPDAIHASDVDLMNWAKKGVIIPVEDLIDK-DEKPEYKALMTAPDGHIYSFPWIHSVNDMAWINKDWLKKLGLEMPKTTDDLIKVLEAFKNDPNGNGEADEIPFTFISGNGNEDFKFLFAAFDIGDNDDHLVVGNDGKVDFTNDNYKEGVKFIRQLQEKGLIDKAFEHDWNSYIAKGHDQKFGVYFTWDKN-----NVTGSNESYDVLPVLAGPSGGMGFARDKMVITSVNKNLELTAKWIDAQYAPLQSVQNNDAKWRLDLIKEYYVPYMSNDNNYPRVFMTQEDLDKIAHIEADMNDYIYRKRAEWIVNGNIDTEGLSDYLAIKQKYYDQ 532
30 -34.000IDP04509 iron compound ABC transporter, iron compound-binding protein [Clostridium perfringens ATCC 13124] CPF_0440 [Clostridium perfringens ATCC 13124]  ali follow..  14  1.....MLKRKKLLALTLTALVSMGVLAGCGQKNQEAKETGSGEKVVNVY----SSRHYDIDKQLFKDFESDTGIKVNLVDGKSDELIERMARE-GDNTSADVFLVGAENIAQLNEKDLIKDISS------EKINENIPSEYRGKNWVGL---TSRARIIVYNKEKVNP---ETIKTYNDLTK---------------DEFKGKVLTRSSSSSYNNALLSSFIQLDGAE-----------------KAKEWAQGIVNN--FARTPEGNDRDQAKAIMAGIGDVGIMNSYYIAKMISSSDAEEAKVGKEIGVLFPENTHLNLSFGAVTKNAKNEENAVALLEYLTEEKAQKAYVDENGEFALNTKV.................................................................. 311
31 -31.500IDP04248 ABC transporter, substrate-binding protein [Clostridium perfringens ATCC 13124] CPF_1477 [Clostridium perfringens ATCC 13124]  ali follow..  18  1.......MKKKILATLLTGLVLGTSLVGCGK---TEGAEAGKKLVVSTW----GLNEDVLKETVFEPFAKEHGVEIVLDIGNNSERLTKMKNN--PNSQIDITYLAESFAEQGVEAGIFDKLDSKIPNASEMNEKAKST---VEAGYGPAYTLN-SIGIVVDPSAGIE-----INSWEDLWKPELK--------NKIAIPDITTTNGPA-------MVEIAAEKAGVDVKTDNGEAA-------------FKELEALKPNVVKTYSKSSDLANMFSNGEIVAAVASDFAFGTISKAKPE------------PESGTYLNFNTININKNSKNKDLAYEFINYALSKEVQEKTAKALNESPVNKEVKLSEE............................................................. 310
32 -31.400IDP91956 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005733 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  12  1........MFKNFKKIAFTSSLI-LLAACSNNASNTNGSVDKSQEIVIY----TNSASNGRADWLQTKASEQGYNLRLVDISGGELADRLIAE-KNNAVADMVILNKLEFNRIKAEKLLVKYSP--KWADEVDSSLGDS---EGYYSPI---VNQPLVLIGNKDA------KMPSDWTDFTD---------------SSYKGKYGISKLSTGTSKNIFASIVSRYKDEKGELGISD---------EGWKVAKAYLKNAHVYA----EGEDYISSIMDNNNDLKYSMMWGSGVLQNQKEREYKFQVM-----PKVGVPYVTEQVGILNTSKKQALLKEFVDWFGSSELQKEWSDKFGSIPANKKALEQAKDELKQFANS.................................................... 324
33 -29.500IDP90995 hypothetical protein y1430 [Yersinia pestis KIM 10] y1430 [Yersinia pestis KIM10+]  ali follow..  13  1MRPEVKYMLMKIKVFMFAMAALTTLPAFAQLPSYYPADGAKKEGKVVVY----SATDIKAAAPLIKGFEAAPGIKVEYNDMNSTELYNRYISEQASGSSGDVVWSSSMDTALKLATDYALEYLS------PEQAELPKWAIWKNKAYGS---TYEPVVFIYNKRLIPQA--DMPDTHIALAKLIVS--QPDKFKRKVTTYDIE--------------------KSGLGFM-----LSVQDFKADPNYFTTLANIAKG---GLTVQSSTGTMMERVSSGENLIGFNILGSYAETRAKTDPSLGIAY------PKDYTLVLSRVTFISQKAPHQNAAKLWVDYLLSEKGQNILANQSDIPSIRKDI----------------------DGNNDIDGLTKKLGSALRPI---PVDESLLEYMEQAKRLDYIKQ 362
34 -29.000IDP01937 putative periplasmic solute-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0727 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  1........MSKKFFLSLGLVALLFSNSQAIDENLIKAAQAEGRVNS-----LAMPDTWANWKDTWADLKNLYDIEHSDTDMSSAQEIAKFKTEKKNASG-DIGDVGASFGEIAVKQGVAQPFKT--SYWDQIPTWAKDK---DGNWLLA---YTGTIAFIVNKDVVKDI----PKTWQDLLKGNYK--------ITVGD--------VSVAAQAVSAVLAANYALGGDEKDLS------------PALAFFNTLAKQGRL-----VNNDVSIANLEKGEVEVGLVWDFNGLGYRDKV-GKDRYEVL-----PADGSVISGYTTIINKYAKHPNAAKLAREFILSDKGQINLAKGYARPIRIDHITLPDDIKAKLLPSEQYKNARAIKDQKAWEKSAKELPQLWQEKVIVDMK.................. 348
35 -29.000IDP05164 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_1735 [Bacillus anthracis str. Ames]  ali follow..  17  1.....MKKFSSLKSLFVCTLLFSAVVTGCSSKTGNVDSKTTNEKKIVVY----SAGPKGLAEKIQKDFEKKTGIKVEMFQGTTGKILARMEAEKKKPVV-DVVVLSLPAMEGLKKDGQTLAYKE--KQADKLRSEWSDD---KGHYFGY---SASALGIVYNTKNVKTA----PEDWSDITK---------------GEWKGKVNLPDPALSGSALDFVTGYVKKNGK-----------------DGWDLFEQLKKNEVT---VAGANQEALDPVVTGAKDMVIAGVDYMTYSAKAKGEPVDI--------PKSGTVISPRAAGIMKDSKNVEGAKEFIDYLLSDDVQKQISKA-YLLPGRTDIKAENRPNVEEIPVLNIDWKT---VEKEQDEIGKQFKKVFQ.......................... 341
36 -28.800IDP04270 gene: potD; spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Clostridium perfringens ATCC 13124] CPF_2226 [Clostridium perfringens ATCC 13124]  ali follow..  15  2.......KLKKFLALTCSTLLLSSLFLGCGPKKDEEATQDKNNNVLYVWGDYID-------PELLTKFKEETGIDVKYDV--YDTNEIMYQKLNSGNVSYDIVIPSDYMIEKMKEEDMLAKIDSNIPNYKYIGEQFKNLAYDPTNEYSVPYMWGTV-GIIYNTKRVSD----PVDSWNIL-KYKDQVI-----DSVRDAMAVA------------------EKKLGYSL----------NTENLDQIEAAKKELMTQKKDGLILAYMVDQVKDAMVGGEASLAVAWSGDAVTMIERN-PDLAYAI------PKEGSNKWFDAIAIPKNAKHKENAEKFINFLCDPENAEQNVEYIGYSTPNTAAYDLLPEDIRDAYPDEESLKNCEVFIDLPSKILRKYDEAWLEIKCV..................... 359
37 -27.700IDP00429 gene: sfuA; iron(III)-binding periplasmic protein YPO2958 [Yersinia pestis CO92]  ali follow..  12  1........MKIPIPSIGHVALLASAILFASSANAASDED-----GIIIY----NAQHESFAKSWAEGFTKDTGIKVTLRNGKDSELGNQLIQEGSSSPA-DVFLTNSPAMVLVDNAKLFAPLDA--ATQAQVAKEYRPE---DGRWTGI---AARSTVFVYNPAKISEA--ELPKSLMDLAKPEWK--------GRWAA--------SPSGADFQAIVSAMLALKGEQ-----------------ATLEWLKAMKT----NATAYKGNSTVMKAVNAGQIDGGVIYHYYPFVDQAKTGENSGNIKLHYFKNKDPGAFVSISGAGVLASSKHPQQAQKFVQWVTGKAGQDFLRESNSAYAVGVNA----------------------ASNPKLVPLKDLDPPKVEVSKLNSKKVVELMTEA.......... 336
38 -27.500IDP01388 iron(III) ABC transporter, periplasmic iron-compound-binding protein VC0608 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  4IKVIITSQKEYSMKKLLSLSAITLSVLAPSAFAAQ---------EVNVY----SYRQPFLIEPMFAEFTKETGIKVNVKF-AKEGIAEKLAQE-GEYSPADVILSEFSRLFELTEKGLTQPLDS--VIEENIPAQYRDS---GDEWFAL---TQRTRSVYSSRDRLGKLGD--DFDYMDLAK---------------PEFKGKICTRSGKHPYNIALVASIIANHGEA-----------------EAKAWLEGVKAN--LARKPQGNDRDQVRAIKEGLCDVSLGNSYYLGAMLNDQEQKSWAEAVYIPGQNVQGTHVNVSGMAMAKYSPNRENAQKLMEFLTGETAQKMYAEVNYEYPVKPGV.................................................................. 312
39 -27.500IDP91991 spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100001132 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  15  1........MKKIYSFLAGIAAIILVLWGIATHDSKINSRDSQKLVIYNWGDYID-------PELLTQFTEETGIQVQYET--FDSNEAMYTKIKQGGTTYDIAIPSEYMINKMKDEDLLVPLDSKIEGIENIGPEFLNQSFDPGNKFSIPYFWGTL-GIVYNETMVDE----APEHWDDLWKLEYK-------DGAREVLGLG------------------LNSLGYSLNSKDPQQLE-------ETVDKLYKL-----TPNIKAIVADEMKGYMIQNNVAIGVTFSGEASQMLEKN-ENLRYVV------PTEASNLWFDNMVIPKTVKNQDSAYAFINFMLKPENALQNAEYVGYSTPNLPAKELLPEETKEFYPDVETMKHLEVYEKFDHKWTGKYSDLFLQFKMYRK................... 356
40 -26.800IDP00471 gene: tbpA; thiamin transporter substrate binding subunit YPO0522 [Yersinia pestis CO92]  ali follow..  11  1..............MFKHIISCLLLISATSALAAEKP-------TLTVYTYDSFAADWGPGPAIKQAFEAECDCQLKFVALEDGVSLLNRLRMEGKNSQADVILLDNNLVQAAEQTGLFTPSQV------DTRNLTLPEPWQNKTFVPYDY---GYFAFVYNKEKLK----NPPKSLHELIS---------------SKEPWKVIYQDPRTSTPGLGLMLWMQKVYGD-----------------QAPQAWQQLAQKTVT---VTKGWSEAYGLFLKGEADLVLSYTTSPAYHLIAEKNNNYAAADF-----SEGHYLQVEVAGQLAASKQPELAQRFMQFIVTPAFQNHIPTGNWMYPVIKMD.................................................................. 291
41 -26.700IDP05020 gene: potD; spermidine/putrescine ABC transporter,substrate-binding lipoprotein [Clostridium difficile 630] CD1027 [Peptoclostridium difficile 630]  ali follow..  18  1.....MIKFKKAISLIAVGMMIVTLFTGCNK-----ATDSTKVLNVYNVGDYID-------ESLIDKFEKETGIDVQYST--YDTNEMMYQKVKSGSTHYDLVFPSDYMVEKMKNEGLLEKLDKNIPNMKYLDKSFLNPVYDKTNEYSVAYMWGTL-GILYNKKEVKD----PMDSWNIL-KYKGNIM-----DSVRDTIGIT------------------LKKLGYSMNSVNPKEIN-------EAKNLLMKQ-----KDLVLAYVNDEGKDRLLGGEVAMGMLYSGDAVTLMEQN-PDLDYAI------PKEGTNKWVDAMCVPTTAQNKKEAELFINFLLDPENAKVNAEYIGYSTPNTGALKLLDPEITQ--KEVLDKCETFEDIGENIKLYDKAWIELKS......................... 349
42 -26.100IDP01395 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein, putative VC0704 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  1MTNFCNEWVSYSQMIKRFLSLMVLNTVC--------YQASALELNVYLWEDTIA-------PSVVEAWHKKTGVSVNLFHFDNDDERSLLMLK-SVQLPFDIMVLDNVSAFIFSRQNVFEDLTA-LPNRANNDPMWLQ----ACGTHAVPYFWGSV-GIAYRKSLFDK----PPTQWSEVVDIAPAHRGR---KDSVETLLPA------------------LYMLNASPITDSIDTLR-------QAYRLLDAANPHILT----EYVLSYVRSHPQTDNLHMAVSYSGDHYSLNRFNTQDWDFSV------PEGRPYLWVDCMAVNSVSPNTVQAKAFLDFLMKPDIAAINAEYIRAASPNYKARALLPVEHREIYLPEQRLAEGIIDSELSAKNLSLRAKIISSVTYQYEA.................. 357
43 -26.000IDP05673 hypothetical protein lmo0810 [Listeria monocytogenes EGD-e] lmo0810 [Listeria monocytogenes EGD-e]  ali follow..  15  1.......MKQLLKIFVPVIVVALLMMLLATTMNRSEGYAGSNTLTIYNWGDYID-------PSLITKFEKETGIKVIYQT--FDSNEAMMTKIEQGGTTFDIAVPSDYAISKMKEENLLIPLDSKLPNEKYLDPRFMDLSFDDDNKYSMPYFWGTL-GIIYNKEMFPDKNFD---TWNALFDPELK-------DGAREVMGLG------------------LNSLGYSLNDTNKAHLQ-------AARDKLETM-----TPNVKAIVGDEIKLLMADNEAGVAVTFSGEAAEMLSEN-EDLEYVI------PKDGSNLWFDNMVIPKTAKNVDGAHKFINFMLKPENAAINAEYVGYATPNAKAVELLPKEISSFYPDMDELNNLEVYDNLGKRMLSYYNELFLEFKMYRK................... 357
44 -25.600IDP92649 iron ABC transporter, iron-binding protein [Streptococcus pneumoniae TIGR4] SP_0243 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  15  1........MKKKWMYYAACSSNESADDSSSDKGDGG--------SLVVY----SPNSEGLIGATIPAFEEKYGIKVELIQAGTGELFKKLESEKEVPVA-DVI-FGGSYTQYTTHGELFENYTS--KENDNVIKEYQNT---TGYSTPY---TLDGSVLIVNPDLTKG---MNIEGYNDLFKPELK--------------GKIATADPANSSSAFAQLTNMLQAQGGY--------------KDDKAWSYVKDLFTL--IDGKIGLSSSGVYKAVADGEMTVGLSYEDPAVKLLNDGAN------------PKEGTVFLPASAAIVKKSKNMENAKKFIDFIISQEVQDTLGTTTTNRPVRKNAKTSEN------MKPIDKIKTLTEDYDYVIKNKSDIVKKYNEVFTDIQSKQ................ 338
45 -25.600IDP05035 gene: potD; spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Bacillus anthracis str. Ames] BA_1300 [Bacillus anthracis str. Ames]  ali follow..  17  2..........KLTKRLAGAAISFSLVAGCGEKK--------EELNIYSWADNFD-------EQVLRDFEKKYNVKINYDK--YASNEEMLAKLQAGGAKYDLIQPSDYMVKTMAKMDLLAPLDKNIPNIENMVSNFKTPAFDPENKYSLVYTWGVT-GIAYNKKYVKE----APTSWTDLWNEKYK-------NDSREVLGMG------------------LKKNGFSNSTKDDAQLK-------TAATDLQKL-----LPNLLAFDTDNIKQKFITEDAWIGTVWSGDAAFIAKDN-KDVEYVV------PKEGGTIWADTLAIPKGAKNKELAEKFMNYLLDEKVSVKNYESIGYSNPNEKAHPLHSKEYREMIFLTKEELDRTEWLVDVDDKLKDYDRYWTELKTKGK................... 345
46 -24.300IDP01418 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VC1424 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  1........MKNKLFASALCAAALFTTNA---------MAKDQELYFYNWSEYIP-------SEVLEDFTKETGIKVIYST--YESNESMYAKLKTQGAGYDLVVPSTYFVSKMRKEGMLQEIDSKLSHFKDLDPNYLNKPFDPGNKFSIPYIWGAT-GIGINTDMLDKKSLK---NWGDLWDAKWA-------DDAREVFHIA------------------LSKLGYSPNTTNPKEIK-------AAYRELKKL-----MPNVLVFNSDFPANPYLAGEVSLGMLWNGSAYMARQEG-APIQIIW------PEKGTIFWMDSISIPAGAKNIEAAHKMIDFLLRPENAAKIALEIGYPTPVKTAHDLLPKEFANSIYPPQSVIDNGEWQDEVGEASVLYDEYFQKLKVND.................... 345
47 -23.900IDP01506 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VCA1113 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  1........MKTFIKGLVLSAVVA-----------SSQVYAEQTLNVYAWGGYLP-------EKSLKAFEQQEGVTINYSTFENNEMYTKLKLL--KGTGYDVVFASAYFIEKMGREGLLAEIDNQIPNMKDAMPTVLGLAHDPQNKFSLPYIWGIT-GLYYNSSTLPN----GITKWADLWDKQYE-------DDIRDVFGMA------------------LKLNGFSINTKNEEEIK-------KAYESLVAL-----KKNVLLYNSDAPHVPYVSGEATLGMQWNGNAYQGQVEM-PELKFVM------PEEGAVLWMDNFTIPSGSKNIPLAHKFINFMYQPENQAEIVQSLGYASATKGGRALLPAELRD........................................................ 305
48 -23.800IDP01419 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VC1425 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  17.FSLELTSMKKLATLLAGSACALSLLSGTAA-------AEDKELVFMNWGPYIN-------SGILEQFTKETGIKVIYST--YESNETLYAKLKTHNQGYDLVVPSTYFVAKMRDEGMLQKIDSKLSNFKNLDSNYLDKPYDPNNDYSIPHVVAIT-GLAVNTDMYDPNDFQ---SWGDLWKPELK-------DDTREVFHIA------------------LRKLGYSGNSTDDKQID-------EAYAELQKL-----MPNVLVFNSDNPAAPYLSGEVGLGMLWNGSAAAAQKEG-LPIKLVF------PKEGGIGWVDNFAISSGAKNVDAAHKMIDFLLRPEIAEQISRDTGYLGVKASNDKFQDVAPLFPSQEDLDRVEWQSAVGDKTVKYEEYFMKLKA......................... 364
49 -23.700IDP00421 gene: potF; putrescine transporter subunit: periplasmic-binding component of ABC superfamily YPO1331 [Yersinia pestis CO92]  ali follow..  10  1.....MFTQRKKWLSGVAAGLLMAASVSASAEE--------KILHIYNWSDYIA-------PDTLANFQKETGIKVVYDV--FDSNEVLEGKLMAGSTGFDLVVPSASFLERQLSAGVFKPLDSKLPNEKNLDPELLALVSKPDNKYAIPYLWATT-GIGYNVEKVKAV--APVNSWDLVLKPENLEKLKSCGDAPSEIFATV------------------LNYLGKDPNSTLTADYTGSATDLLLKLR-----------PNIRYFHSSQYINDLANGDICVAVGWAGDIMQASNRAKVNVAYSI------PKEGALAFFDVFAMPTDAKNQDEAYQFLNYLMRPDVIANISNHVFYANANQAATPLVNAEVRDIYPPADVRAKMFTLKVQDPKIDRVITRAWTKVKSGK.................... 369
50 -22.600IDP01491 ABC transporter, periplasmic substrate-binding protein VCA0603 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  1........MERMMNKRILKGTLTAIAALMSAHAFAGQ-------EVTVY----TAFETDLLAKYKSAFEKENDIEIKWVRDSTGIMTAKLLAEKDNPRA-EVVWLAGSSMALLKDQGVLKP---YTPKGANELRANLNDPQAQQAWYGN---DAFFNAVCFNEAVAKQLNLPKPQSWEDLTNPVYK--------------GHIAMPNPASSGTGYMQVSAWLQNMGED-----------------KAWDYMQRLDQNI---AHYTHSGSKPCVQAGMGEVAIGISMATRGAKLKTQGAP------VIVPNG-------IGWESEAVGLVKESDAAKRVVDWSVSKAANELYIES-YPIVGHQDVSKQVP------NYPNVEKVMAKMDFTQMGVDRARVLQTWSEKFDAKSEPKS............... 339
51 -16.700IDP01383 thiosulfate ABC transporter, periplasmic thiosulfate-binding protein VC0538 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  1........MNR-----IKSTLTALLLAGSFQASAADQ-------TILNSSY---DIARELFVAYNPVFAEKTGKTVEIKQSHAGS--SAQARSILQGLAADVVTFQVTDVQILHDKGKLIPAN-----------------------------LPNASSPYYSTTAFRKGNPKNIQDWSDLVRDDVKSVFPNPKTSGNARYTYLAALGFAQKQF--------------------------GQDNQVQQDEFLKKFLANVAVFDTGGRGATTSFVERGIGDVLITFESEVNNIRQQYGADD-----QVVVPKTSILAEFPVAVVEKVAKRNGTYDVATEYVSYLYSEPAQRLLAEF-NYRVHDAKVQAEFAERFPAV--------------------------TVEGIAGGWEQAMQTQFANGAKLDQLLRR 333
52 -15.400IDP05442 putative lipoprotein [Bacillus anthracis str. Ames] BA_0171 [Bacillus anthracis str. Ames]  ali follow..  31  1.......MSKKLLSLFSAVIVAAFVITGCGQSDTTNKEQKENAAK................................................................................................................................................................................................................................................................................................................................................................................................. 38
53 -14.000IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames]  ali follow..  27  1.......MLKKLGILVLGSAVALS-LVACGDSTKEASNEKKEEPK................................................................................................................................................................................................................................................................................................................................................................................................. 37
54 -13.600IDP05622 ABC transporter, substrate-binding lipoprotein [Clostridium difficile 630] CD0999 [Peptoclostridium difficile 630]  ali follow..  15  1........MKKYISIILLVVLTMVVLVGCSPGKDNPKNKELSVVKQVKVAVPDGLPAVAIAKLANENPEIKEGYETVYSIEKTPE---AISTRVMKKDA-DIAIVPSNMAAIAYNKTSSYNIVGTVGMGSLYLENIKDYSDLVGKEVGCTGKGLTPDITI--KSLLLQKDINY................................................................................................................................................................................................................................................................. 162
55 -13.600IDP05439 hypothetical protein lmo2499 [Listeria monocytogenes EGD-e] lmo2499 [Listeria monocytogenes EGD-e]  ali follow..  12  1.......MKKKYLGIVAMLAAVMLVFAACGSDSSSADKANGSTKSLTA---VGSTALQPLVEAASKEFTNTNKAQINVQGGGSGTGLTQVQQGAV-----EIGNSDVFAEEKDGVDA--SKLVDHRVAVVGMAPVVNKDVGVKN------ITKQQLIDIFTGK-----------TNWKDV---------------------------------------------GG----KDEKITIINRAEGSGTRATFEKLDGKTPIKAQEQDSSGTVRKIVSETPGAISYLAFSYIDASVVGLSLD---GVEPTEDKVATNDWKIWSYEHMYTNGEPKGLTKTFLKYMTSDEVQNNIVPQLGYQSIKSMKVERDASGKLTDVK..................................................... 302
56 -12.700IDP05010 putative lipoprotein [Bacillus anthracis str. Ames] BA_4934 [Bacillus anthracis str. Ames]  ali follow..  15  1........MKKVLMLFVLLLTASILLIGCSTKKEKAGMNLEKAQKVEIESLTDSSTDKKEIEKLFEVMKMDK...................................................................................................................................................................................................................................................................................................................................................................... 69
57 -12.300IDP05504 gene: modA; putative molybdenum ABC transporter,substrate-binding protein [Clostridium difficile 630] CD0869 [Peptoclostridium difficile 630]  ali follow..  12  1........MKKILGILGLVACLTLGTVGCNSNEDKKTTKSSDSVELNI---SAAASLKEAMAKIEEEYKKVDNVKLTVNYGASG----SLQQQIEQGAPCDLFIAGQKQMKVLDEEKLLVS-DSSVSGMKDLTTDKVKKIAV-GEAESVPAGK-------YADEVLTNLNL-----KDKL------------------------------------------------------KDKLVFAKDVKEVLAWVQS---------------GNADVGFVYFSDTVNNDKIKVVEKTDEKTHSPITYPVS------------------VIKASKNVDAAKKFEEFLLSESGQKIFEE............................................................................. 263
58 -12.200IDP05207 putative sulfonate ABC transporter,solute-binding lipoprotein [Clostridium difficile 630] CD2365 [Peptoclostridium difficile 630]  ali follow..  11  1.....MKLSKKIQALILFGVMGTSILTGCSSKEKEEAKTGKDDYTITVGYYNCDHMTAGPVAESAGIYKDL-GLNVKTVGNG------KVPEAMAAGKM-DAGYIGTKGLVGAIPKGSPITIAANNHTGGSEYKDIKEPKDLIGKKIATDMSDFLWTSDYGPETALKTGKIQAFTSCDPWGSVAEN-----------DGAGKIIASTQYKEKANGKEYNCCSFSLNKNFIKEHPDLAKKLVLAHTKAIEYIYT................................................................................................................................................................................. 257
59 -11.600IDP05398 putative phosphonate ABC transporter, phosphonate-binding protein [Bacillus anthracis str. Ames] BA_3750 [Bacillus anthracis str. Ames]  ali follow..  16  1.......MLKKFFAMSTTVVLAAGLLSGCGTKESSANKNADKTLNVQFVPSQNADTLEAKAKPLEKLLSDKLNIPVKVSIST----YNTIVEAMASKQV-DVGFLPPTAYVLAHEKKAANVIAPKKDLVDFYKSEFVSVKDLKGKKIGYQ-DVTSSAGYVWPAAVLLKEGVDPLKDVKPVTLKGHDQSLIALLNGDVD........................................................................................................................................................................................................................................ 214
60 -11.400IDP00164 gene: acfC; accessory colonization factor AcfC VC0841 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  1.....MYFMKSKNRFLLISLLSF---------------STSVFADVNLY---GPGGPHVPLIKVAESFEKSQSKRVNITFGPQATWNDKAK------KNADILFGASEHSALAIAEGHSERFSK-----------------------------FNIHPVFMRE-ILVKKG---PKNIKGMADLLKP--------------------------------IGIVVNDGAGVSNTSGTAVWEDSVGRMKNVEKLQAFRSN--IHVFAPNSGSARKAFVDGEDIDAWITWVDWAIANPTIG------DMVRMEDEYRIYR-----DFNVVLAKNPSSEAIDFFDYLTKSKDAEAIFQHYGWF........................................................................ 255
61 -11.300IDP91135 hypothetical protein SAOUHSC_00137 [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00137 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  11  1........MKR---LSIIVIIGIFIITGCDWQRTSKERSKNNQQVIKIGYLPITHSANLMMTKKLLSQYNHPKYKLELVKFN-----PDLMDALNSGRI-DGASTLIELAMKSKQKGSNIKANVIMGQKGMHLNEFNNNGD--DYHFGIPHRYSTHYLLL--EELRKQLKIKPGHF--SYHEMSPAEMPAALSEHRITGYSVAEPFGALGEKL-----KGKTLKHGDDVIPDAYCCVLVLRGELLDQ-DVAQAFVQDYKKSGFKMNDRKQSVDIMTH......................................................................................................................................................... 263
62 -11.100IDP05024 ABC transporter, substrate-binding protein, putative [Bacillus anthracis str. Sterne] BAS4675 [Bacillus anthracis str. Sterne]  ali follow..  14  1..................MLLAVFTFAACSSKKEGTKE---QTQNIRIGEVTHSLFYAPLYVGIEKGFFKDEGLNVDLQTTAGG---DKTMTALLSGGI-DIALVGSETSIYVHQQGAKDPIINFAQLTQTDGTFLVNWNDVKGVTFLGQRKGGMPQMVG--EYVLKKNGIDPHKDTNLIQNIEFANIANAYASGTGEFVQLFEPTASISFGNESGTVPYTSFMAKESFLKKDKAAAEKFTRALYKAQQWVDT................................................................................................................................................................................. 245
63 -11.100IDP02672 hypothetical protein FTT1602 [Francisella tularensis subsp. tularensis SCHU S4] FTT1602 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  13  1........MKKQL-FAISITTALLVLSACGQTGSSIMVKQNQQNNSTSTSDNQSDTSTKVDNDPTAPVRNNNPTTSELFEGE--NYNNNIQNSQNAGGTPTL........................................................................................................................................................................................................................................................................................................................................ 114
64 -10.700IDP05670 hypothetical protein lmo0617 [Listeria monocytogenes EGD-e] lmo0617 [Listeria monocytogenes EGD-e]  ali follow..  12  1.....MKKLKSILLLMGIITFAL-ALTACGGTEDKASTEKIETAKAE--------------TKKKSNPNELGDYKVEILSSEVVKDFEGIKTKFTNNSKENISFMVAIDQQAFQNGTQLETTVSADASMGGSEKDVQPGGTLEVTEYKLQDTQNTVDIEATE............................................................................................................................................................................................................................................................................ 148
65 -10.500IDP91970 lipoprotein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005433 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  13  2.......KIKKWLGLVALATVAGLALAACGNSEKKADNAT----TIKIATVNRSGSEEKRWDKIQELVKKDG---ITLEFTEFTDYSQ--NKATADGEVDLNAFQHYNFLNNWNKENYISPIRLYSGLNGSANKYTKVEDIPANGEIAVPNDATNALYLLQSAGLIKDVSGTALATVANIKENPKNLK.................................................................................................................................................................................................................................................. 188
66 -10.400IDP91987 ABC transporter substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100008765 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  13  2.......KKTWKVFLTLVTALVAVVLVACGQGTASKDNKEAELKKVDFWTP--NTNHTGLYVAKEKGYFKEAGVDVDLKLPPEES-----SDLVINGKA-PFAVYFQDYMAKKLEKGAITAVAAIVEHNTS-SDNVSSPKDLVGKKYGTWNDPTELAML---KTLVESQGGDFEKV--EKVPNNDSNSITPIANGVFDTAGVDANFMYLKDYVKEFDYYSPVIIANNDYLKDNKEEARKVIQAIKKGYQYAME................................................................................................................................................................................. 258
67 -10.000IDP05658 hypothetical protein lmo0207 [Listeria monocytogenes EGD-e] lmo0207 [Listeria monocytogenes EGD-e]  ali follow..  16  1.....MKMLKKGTAVLFV-MIMAVMLVACGDKEETKTSQNGVDSKLTYTYVASKEDAEKMLKATSDKFQGIDGLKEKIEY.............................................................................................................................................................................................................................................................................................................................................................. 97
68 -9.840IDP05592 putative lipoprotein [Bacillus anthracis str. Ames] BA_3194 [Bacillus anthracis str. Ames]  ali follow..  11  1........MKILK-FGIIGALSITLLIGCTSNSNETKASNKEASTAVKEKEIVYENVMFEQKEVRKQVVNTENIKTIFTSME-SAEKKTLLLDQEAKNYIHS------KMKVTYQDNSIQEFFVWIESDSD-IVIAKASDETHGEGYDLREDNSKKIIQFFEKEF......................................................................................................................................................................................................................................................................... 160
69 -9.780IDP04197 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_2510 [Clostridium perfringens ATCC 13124]  ali follow..  14  1........MKKLLVPVLVIIIFALLFVGCTNSSNSSSDSSVEIINSN--DTKKSDSNNASHKDNKDNNVSNNKNTNKKLDNKAEKLLKDIKEKAVKGEIIDYFKLGDSIYDVIDKLGKPSSENYVCNKGDQIFEIRSLNKDLKSNFFGKPDYTVDHYSVLYPSITHNSMAGDNGREW............................................................................................................................................................................................................................................................. 237
70 -9.750IDP05148 putative lipoprotein [Bacillus anthracis str. Ames] BA_0177 [Bacillus anthracis str. Ames]  ali follow..  13  1........MKKII-FVSSLVLAISLGVGCSNEKTAKTDEPKKESVQK----EKELTAKDVFKKTNEAFKNEEHVTMTYGVGVKAEGTEMDIVKAKMQLEPKTKNSRSE.................................................................................................................................................................................................................................................................................................................................. 95
71 -9.750IDP02402 hypothetical protein FTT1778c [Francisella tularensis subsp. tularensis SCHU S4] FTT1778c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  1.......MKLRKVLIATLLGASALSLSSCWLLVGAAVGGGTAAYISGEYSMNMSGSVKDIYNATLKAVQSSTSFYVKIEKLTDNASKVTIKFGTFGDQA........................................................................................................................................................................................................................................................................................................................................... 117
72 -9.640IDP04512 gene: modA; molybdate ABC transporter, molybdate-binding protein [Clostridium perfringens ATCC 13124] CPF_2342 [Clostridium perfringens ATCC 13124]  ali follow..  17  2.......RKKISLPIIMAIGMLSLLFVGCTNNKEEKTLTVSIAASLQ-----------KPMEKIASNFEKENGVKIQYNVGGSG----TLKKQISDGADVDLFFANTKYAKELIDEGLVNKLVLIENNDYNKPINSLEDLKNVEGKIAIPAGQ-------YAKESLEKVGA-----YKDI------------------------------------------------------EDKLVFARSVTNVKTYVEN---------------GEANLGFVYKTDALDLKNSKIVYEVPNDYHKPIEYELC------------------LLKNSKNNKEAKKLIEYLKGEESKKIFSE............................................................................. 250
73 -9.600IDP05678 hypothetical protein lmo1041 [Listeria monocytogenes EGD-e] lmo1041 [Listeria monocytogenes EGD-e]  ali follow..  13  1........MKKIVLIICCGLLL--LLGACEDTPEKVQTT-----TIHI---SAAASLKDSIDDVKPLFEKANTIKLSFDFGGSG----QIRERVESGAPIDGVLASKKDADTLIKQNLAEKTKEFAGNELVLIEPKNVDQKTEGDPESVPAGA-------YAKQTLENLNL-----YNAE------------------------------------------------------KAKLVLATDVRQVLSYVEA---------------GNADAGFVYQTDALLSKKVQVKAKIDEKLHDPIAYYSA------------------QVSDSDKKEETATFLDFMNKSEAQKILEKYGFKAA....................................................................... 255
74 -9.570IDP05554 hypothetical protein CD3669 [Clostridium difficile 630] CD3669 [Peptoclostridium difficile 630]  ali follow..  11  1.......MKNKKIMLVLSILSISIFAVGCTNAQNGSDSSKKKAQSATIYSFDVDKTDLIENKVDLNKIDENTLFEELQKLKVVPESAKLNSFTTKDIDGVKTGILDVSSDFTKSNLGSDAELDSVARTYIKNMNVEQIKITVDGSNY--------------------ESGLEEGDYLK............................................................................................................................................................................................................................................................ 191
75 -9.500IDP05631 ABC transporter, substrate-binding protein [Clostridium difficile 630] CD1979 [Peptoclostridium difficile 630]  ali follow..  19  2.......NFKKLGILGLVSVFTLATITGCSSNNNKDKNNDKKKVTMVLWTP--NTNHTGLFVALDKGYYKEEGLDVEIVQPPESG-----ETLVATGKA-DFGISYQEQVTYAKTSEDPLPIKAVATVIQHNTSGFATAKDFEGKTYGGWGSPSEEAVF---KAVMKKNRADFNKL--KIVNTGQDDFFAAMKT-KADLIGYDLNFIPVKDLDERLDYYTPLIISNETVLKDNPELAKKFLKATTKGYEYAIK................................................................................................................................................................................. 260

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.