current user: public

If you have questions about the server, please let us know.

Query: IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MLKKLGILVLGSAVALSLVACGDSTKEASNEKKEEPKQEAKKENKENKESKKKITAADVEAIKVGDSLTGAGGEKYEDVVAKFGEPDNKAESQAGDIKMIIASWTKNVNGDLGANFNVTFTEKDGQKLATSKAQMGMKLast
1 -63.200IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames]  ali  100  1MLKKLGILVLGSAVALSLVACGDSTKEASNEKKEEPKQEAKKENKENKESKKKITAADVEAIKVGDSLTGAGGEKYEDVVAKFGEPDNKAESQAGDIKMIIASWTKNVNGDLGANFNVTFTEKDGQKLATSKAQMGMK 138
2 -31.500IDP05476 putative lipoprotein [Bacillus anthracis str. Ames] BA_2745 [Bacillus anthracis str. Ames]  ali follow..  17  1.MKKSTLILCSLCLGFSMTACEQKKEVKKQTATSSTVMENQKKES----------------ININHFSNINEGMTYKEVKDLIGFEGDLLIEEGVEHSTQIKQIFAWKGSNPTALVEITFLDGK----VHSKVQQGLS 117
3 -28.000IDP04197 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_2510 [Clostridium perfringens ATCC 13124]  ali follow..  17  1MKKLLVPVLVIIIFALLFVGCTNSSNSSSDSSVEIINSNQQNSNSNNNNSSNNDTKKSDSNNASHKDNKDNNVSNNKN............................................................ 78
4 -27.500IDP05442 putative lipoprotein [Bacillus anthracis str. Ames] BA_0171 [Bacillus anthracis str. Ames]  ali follow..  25  1MSKKLLSLFSAVIVAAFITGCGQSDTTNKEQKENAAKENKTEKTDTTKENKPEEKNPK................................................................................ 59
5 -26.800IDP05677 hypothetical protein lmo1068 [Listeria monocytogenes EGD-e] lmo1068 [Listeria monocytogenes EGD-e]  ali follow..  15  1.MKKWMVIISIISLVALLGACGNNDNEKDQEDKSTTDSTTKKAKSSSNESNKAAETKENDTNDKAATTDKGSSNPTKEEKDTSTTTDTPKKETPKSPAK....................................... 98
6 -26.200IDP05121 conserved hypothetical protein [Bacillus anthracis str. Ames] BA_0915 [Bacillus anthracis str. Ames]  ali follow..  16  1MLKKFTTCILGGALVFNLSGCGNTSDKTSSESKETNSKQEEKNVQTTDEAKTKENTKQKNTEQTKEKSKIKEKE--KDFHTPKFDVTVKRVVERDKVGKESIGFQKPEDGHVFIVVEAEGKNTSEPMKLAFLPSVDL. 140
7 -25.300IDP05009 putative lipoprotein [Bacillus anthracis str. Ames] BA_4237 [Bacillus anthracis str. Ames]  ali follow..  15  1.MKAWKSIFVLCSFLLMLSGCFHQEEKKVEPKKKESIPETKEYGGRELKKVGQKVKETG............................................................................... 58
8 -23.600IDP05267 hypothetical protein lmo0255 [Listeria monocytogenes EGD-e] lmo0255 [Listeria monocytogenes EGD-e]  ali follow..  23  1.MKKFLSILSILVLALLVTACGSDSSDKKSAKKEEKMETVTYIADINGAKLE...................................................................................... 51
9 -23.400IDP05588 putative lipoprotein [Bacillus anthracis str. Ames] BA_2883 [Bacillus anthracis str. Ames]  ali follow..  15  1MKVKIALLCLTFTCIFALAACKGTDEKKETNPTSENSKNEQNTSSEGKKEPEVKSNTDSNSKDIVINQKSINTGDIEEIEKAWGKADKTEQ............................................... 115
10 -23.300IDP05148 putative lipoprotein [Bacillus anthracis str. Ames] BA_0177 [Bacillus anthracis str. Ames]  ali follow..  17  1.MKKIIFVSSLVLAISLGVGCSNEKTAKTDEPKKESVQKEKELTAKDVFKKTNEAFKNEEHVTMT......................................................................... 64
11 -22.500IDP05670 hypothetical protein lmo0617 [Listeria monocytogenes EGD-e] lmo0617 [Listeria monocytogenes EGD-e]  ali follow..  37  3KLKSILLLMGIITFALALTACGGTEDKASTEKIETAKAETKKKSNPNELGD....................................................................................... 53
12 -22.400IDP05763 hypothetical protein lmo2331 [Listeria monocytogenes EGD-e] lmo2331 [Listeria monocytogenes EGD-e]  ali follow..  16  1.MKKGIALLAGFMLAIFLTGCGGTDNTRKENHSDGSAEVKNKKDNNTSDEYVEDG................................................................................... 56
13 -22.000IDP02672 hypothetical protein FTT1602 [Francisella tularensis subsp. tularensis SCHU S4] FTT1602 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  1.MKKQLFAISITTALLVLSACGQTGPLYLPDEDKLNSGSTLAKSGSSIMVKQNQQNNSTSTSDNQSDTSTK................................................................... 70
14 -21.400IDP05460 putative lipoprotein [Bacillus anthracis str. Ames] BA_0985 [Bacillus anthracis str. Ames]  ali follow..  10  1.MKKIISICALTALSFTLIGCASTSATDKSPQAKQEHKQNAFQLNSANITDIEILQTTNNTTSKSQTDNKEMIQSIVSAVQKGTPKTITLDQKKRKSAHSTITVTYKDDAKEEFLVWVDNKEQITIVTVNIKNTKMMK 148
15 -21.000IDP05429 hypothetical protein lmo0791 [Listeria monocytogenes EGD-e] lmo0791 [Listeria monocytogenes EGD-e]  ali follow..  22  1MKKGLFSMVLVLAMVLVLSACGASRVEPKKAGEITVNAVVYNKDTDKVKDVYGEDGSK................................................................................ 58
16 -20.500IDP05554 hypothetical protein CD3669 [Clostridium difficile 630] CD3669 [Peptoclostridium difficile 630]  ali follow..  16  1MNKKIMLVLSILSISIFAVGCTNAQNGSDSSKKETKSNTNVEQPKEENNTEKEVPNNKAKPTPKEE........................................................................ 67
17 -20.500IDP91154 hypothetical protein SAOUHSC_00808 [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00808 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  25  1.MKKVMGILLASTLI--LGACGHHQDSAKKESTSHKKKENDNEELNEELKEFKSKKNMD............................................................................... 56
18 -20.000IDP05592 putative lipoprotein [Bacillus anthracis str. Ames] BA_3194 [Bacillus anthracis str. Ames]  ali follow..  14  1.MKILKFGIIGALSITLLIGCTSNSNETKASNKEASTAVKEKEIVYENVMFEQKEVRKLEPVNSKSSNQVVNTENIKTIFTSMESAEKKT------------LLDQEAKNYIHSKMKVTYQDNSIQ............ 116
19 -19.900IDP04392 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1500 [Clostridium perfringens ATCC 13124]  ali follow..  19  1.MRVLKGVILAIIPAFLFMGCGEFSKNDVAKVSFEKLSEKEEQ............................................................................................... 42
20 -19.200IDP05658 hypothetical protein lmo0207 [Listeria monocytogenes EGD-e] lmo0207 [Listeria monocytogenes EGD-e]  ali follow..  13  1MLKKGTAVLFVMIMAVMLVACGDKEETKTYTLSQNGVDSKLTYTYKGDKVTKQTAENTMSYASLGVASKEDAEKMLKATSDKFQGIDGLKEKIEYKDDKAIETLEVDYTKISSEDMNMSSNGDTSKGISMEESAKMLE 144
21 -19.200IDP05010 putative lipoprotein [Bacillus anthracis str. Ames] BA_4934 [Bacillus anthracis str. Ames]  ali follow..  17  1MKKVLMLFVLLLTASILLIGCSTKKEKAGMNLEKAQKVEIESLTDSSEKKVITDKKE................................................................................. 57
22 -19.000IDP05266 hypothetical protein lmo0047 [Listeria monocytogenes EGD-e] lmo0047 [Listeria monocytogenes EGD-e]  ali follow..  15  1MYKKLATVGMTVLLVGALSACSFNDDKDTSSNNSNNETTSSKSSNNESSSDSLQNKS................................................................................. 57
23 -19.000IDP05125 putative lipoprotein [Bacillus anthracis str. Ames] BA_4310 [Bacillus anthracis str. Ames]  ali follow..  25  1.MKKLIMTLFIAMLA--LAGCNTNKEEPKKEQKLEAVKVAVQTNPKEIKPGEKTE................................................................................... 52
24 -19.000IDP04565 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1805 [Clostridium perfringens ATCC 13124]  ali follow..  18  1MIKKIVVAVGLAFSLSFLVGCGNKSLVEQGKAAIKQGNYEEATA.............................................................................................. 44
25 -18.800IDP05625 putative lipoprotein [Clostridium difficile 630] CD1348 [Peptoclostridium difficile 630]  ali follow..  21  1.MNKIAVSFLIIATTLLSTACMDYSISAVELVDSKESAVVKKDEDAKEETTSKMINS................................................................................. 56
26 -18.700IDP05242 hypothetical protein lmo2079 [Listeria monocytogenes EGD-e] lmo2079 [Listeria monocytogenes EGD-e]  ali follow..  22  1.MKKGILLSILLALVLVISACGESAEEKAAKTPQGKFVQTMKNGMNVPDQ........................................................................................ 49
27 -18.200IDP05454 putative lipoprotein [Bacillus anthracis str. Ames] BA_0190 [Bacillus anthracis str. Ames]  ali follow..  11  1.MRTLLSVLLALMLVPALTGCKAPAKEDTTSNKKTTEEAKNETPADLKKNVAADKKMEAKIEDHKADVNLTGDEAITKLSPLLQELKFDKGTPDQEVIDQVLNVFKLDKDYQKFELEVVFSDGT.............. 146
28 -17.900IDP05486 putative lipoprotein [Bacillus anthracis str. Ames] BA_4573 [Bacillus anthracis str. Ames]  ali follow..  13  1MRAFFRGIGPFLIVVLLLVGCQSEENKIEQKATTTKAEEKVQITKEEEKSIQDVMDKFVRTTNEKNLAESKKMPSAEDLKTQKEA--DIKASKAGYVVVETKEKEIDGEITLQKKVQYAIGKEEDGWKIEEVRTIEKK 155
29 -17.900IDP04063 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_0514 [Clostridium perfringens ATCC 13124]  ali follow..  17  1MNKRVASILTTSLLVTSLVGCVGSNNKANTSSNDSKVQESVENQSDFNDLRT--------------------GKTYNEVSENKGTGNENIEEVAGKKVIVSSSYSTRDDSKNISAVSVHFKGIE.............. 120
30 -17.600IDP05430 hypothetical protein lmo1265 [Listeria monocytogenes EGD-e] lmo1265 [Listeria monocytogenes EGD-e]  ali follow..  16  1.MKNRITMIAGIVCLSILTACSSSESVKGTTSEEQTTSQSGAEMIKANNGV....................................................................................... 50
31 -17.600IDP05272 hypothetical protein lmo1649 [Listeria monocytogenes EGD-e] lmo1649 [Listeria monocytogenes EGD-e]  ali follow..  30  1.MKKWLLVVLTLALGLSLAACSGSNSSDKKEDTKKETTSDKDK............................................................................................... 42
32 -17.500IDP05515 putative lipoprotein [Clostridium difficile 630] CD1687 [Peptoclostridium difficile 630]  ali follow..  20  5VKKSISLMIILTIFIFMLTACEKDEQPDSVDIQTEDKNEIKIDEGNAKV......................................................................................... 53
33 -17.500IDP05507 putative lipoprotein [Bacillus anthracis str. Ames] BA_5374 [Bacillus anthracis str. Ames]  ali follow..  15  1MRKLGLITALFALLFSSFTGCDNSPLDKKVKEEAKRTEKEKGPKLTKMSTES...................................................................................... 52
34 -17.400IDP05483 putative lipoprotein [Bacillus anthracis str. Ames] BA_3005 [Bacillus anthracis str. Ames]  ali follow..  13  1.MRRMLLIIISAIAAFALAACTGNKVDESTSKNFISKAEEIVSLLNEAKYKEVHEKFDSK---MTAALSEEKMKDLTPIIEKAGTFEKIEKQSIEEKDGLYTVILVAKYSKEQRTFIITYNDKEEIAGLVIK...... 128
35 -17.400IDP91126 extracellular solute-binding protein, putative [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00176 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  24  1MSKILKCITLAVVMLLIVTACGPNRSKEDIDKALNKDNSKDKPNQ............................................................................................. 45
36 -17.300IDP05089 putative prophage LambdaBa02, lipoprotein [Bacillus phage lambda Ba03] BA_4065 [Bacillus anthracis str. Ames]  ali follow..  28  1MFKKILILIFTALCTLTLSACSSDSSSASKNTTKNEAKEIPTEVRS............................................................................................ 46
37 -16.900IDP91953 extracellular solute-binding lipoprotein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100002215 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  34  1MFRKLACTVLASAAVLGLAACGNSGGSKDAGKSGGDGAKTE................................................................................................. 42
38 -16.800IDP05268 hypothetical protein lmo0366 [Listeria monocytogenes EGD-e] lmo0366 [Listeria monocytogenes EGD-e]  ali follow..  23  1.MKKLIIVMLTIFTAVLVVGCSGTGTADKAETKKETTKESKQANAVKKEVKEMKSNLDDVKKAISDKDKSALQSSAAELHKHWLEFENNVRDLYPL.......................................... 95
39 -16.800IDP04058 ABC transporter, solute-binding protein [Clostridium perfringens ATCC 13124] CPF_0556 [Clostridium perfringens ATCC 13124]  ali follow..  14  1MKRKLTVACVTAIAASAFVGCGNKEEAPKDNEKPSTEQAEGSGEKKV--------------LEIAVFEGGFGKDYWDACIDAFEAEHPDVEVKMEANPKIGDIIRPKLSSENTPDF-IYLSTNDQSGIANALIKDKA. 126
40 -16.700IDP06519 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09962 [Enterococcus faecium DO]  ali follow..  28  1MKKRLVIALLNITLLFSLSACGKTNEEVTANIADPMIKKATT................................................................................................ 44
41 -16.300IDP05449 hypothetical protein lmo2595 [Listeria monocytogenes EGD-e] lmo2595 [Listeria monocytogenes EGD-e]  ali follow..  17  1MKKRLLLVSVLMLFIFLTVACGSSEDNEESGEISTKEIELTVDDPIIPTDEN...................................................................................... 53
42 -16.200IDP06532 prophage superinfection immunity protein [Enterococcus faecium DO] AFK58444 [Enterococcus faecium DO]  ali follow..  10  19FYKKVWFWVLAVILIIIIGSALNGGSDSNKASDNGGEKVTKSSTSASSSKEEKSD................................................................................... 73
43 -16.200IDP05607 putative lipoprotein [Bacillus anthracis str. Ames] BA_4862 [Bacillus anthracis str. Ames]  ali follow..  19  1MDRKFSMFMFLGVVLIILAACTTKSVEQVAVKEVPKEGYIILRNETV........................................................................................... 49
44 -15.900IDP05448 hypothetical protein lmo2594 [Listeria monocytogenes EGD-e] lmo2594 [Listeria monocytogenes EGD-e]  ali follow..  14  1.MKKTSIIFIFCTLLF-VTACSTSENQTQATEATGTIEQVETDA.............................................................................................. 42
45 -15.900IDP05485 putative lipoprotein [Bacillus anthracis str. Ames] BA_3234 [Bacillus anthracis str. Ames]  ali follow..  3MKGRNVSVVFIAIVIFIIAGCSNMIGNEDQTIKVQKHVDDTYEDLKVVTDNKQ--------------------QQVKKILNDAHFENKKVQMSRPADYHFVFQFKNPKIEAKATLYQIWVIPNKDKVQLEGKNAATLF 131
46 -15.800IDP04198 oligopeptide/dipeptide ABC transporter, oligopeptide/dipeptide-binding protein [Clostridium perfringens ATCC 13124] CPF_2555 [Clostridium perfringens ATCC 13124]  ali follow..  16  1MKKRKLVALLTAGLAASFVACGGGANNTAQGNGNGSESGGTTKDLSKPERIEASNPS-----ALPDAAKNRTDTLIVGTTDPKGEFVPIYSSTLYDSWVNKLVFDGNEKGEPIPNVAESYEVSEDGKTYTFKLNKGIK 139
47 -15.700IDP02726 maltosaccharide ABC transporter, maltosaccharide-binding protein, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA4229 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  1MKKALSLLTVSALSIGMLSACGPKDSGKKEESKAKKDYD................................................................................................... 39
48 -15.600IDP04088 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_2931 [Clostridium perfringens ATCC 13124]  ali follow..  17  1.MKKGMILLI--LSSFLLVGCDSIKMDKLAANNNERVKTIANDLIGDID......................................................................................... 46
49 -15.400IDP05029 putative lipoprotein [Bacillus anthracis str. Ames] BA_0864 [Bacillus anthracis str. Ames]  ali follow..  21  1.MKKYTLYSLMLLTLLFLSACSNSAQPKEENDVQSIKDVTVKIPETIFTSSKKNETINEDEMKRS......................................................................... 64
50 -15.400IDP05622 ABC transporter, substrate-binding lipoprotein [Clostridium difficile 630] CD0999 [Peptoclostridium difficile 630]  ali follow..  26  1MKKYISIILLVVLTMVVLVGCSPGKDNPKNKELSVVKQ.................................................................................................... 38
51 -15.300IDP05451 putative lipoprotein [Bacillus anthracis str. Ames] BA_0580 [Bacillus anthracis str. Ames]  ali follow..  18  1.MKKIGTMLLFSIL---IAGCTQAQPDLKKPKKEAIATSSTQVNAPSFFHLSVLKDVN................................................................................ 54
52 -15.200IDP04547 amino acid ABC transporter, amino acid-binding protein [Clostridium perfringens ATCC 13124] CPF_0581 [Clostridium perfringens ATCC 13124]  ali follow..  20  5IFKKILSVAMIGGLTLSLAGCGAKTAKENGSNDKVAKIKESGK............................................................................................... 47
53 -15.200IDP90095 ZZZ_0011 [Escherichia coli 042]  ali follow..  11  1LMTIKCLLLAVMVCPFFITACSDKYSEQDRVQAINNADAPFGAGL............................................................................................. 45
54 -15.200IDP05444 hypothetical protein lmo0768 [Listeria monocytogenes EGD-e] lmo0768 [Listeria monocytogenes EGD-e]  ali follow..  31  1.MKKVLLAILSMVLLLSLAACGGSSDSSKDKNGKEE...................................................................................................... 35
55 -15.100IDP05563 hypothetical protein lmo2417 [Listeria monocytogenes EGD-e] lmo2417 [Listeria monocytogenes EGD-e]  ali follow..  34  1.MKKVLGLIFTLSLVLVLTACGGSSDKASSSKDDKQ...................................................................................................... 35
56 -14.900IDP06193 gene: lpp20; lipoprotein [Helicobacter pylori J99] NP_224067 [Helicobacter pylori J99]  ali follow..  20  1MKNVKKILGMSVVAAMVIVGCSHAPKSGISKSNKAYKEATKGAPD............................................................................................. 46
57 -14.800IDP05153 oligopeptide ABC transporter, oligopeptide-binding protein [Bacillus anthracis str. Ames] BA_0656 [Bacillus anthracis str. Ames]  ali follow..  14  1MNKPYKVLSTLAASTLLLSACGGADSGSKKTNTKKVETNKFSAAVKNDGKEI-----KDGSLTYGLVSNSPFAGVLSRVLYEVAPDSEIMDFFDEG------LLASDKNWEITNDGAATYTISEDKKTITIKIKDNVK 129
58 -14.800IDP06544 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09718 [Enterococcus faecium DO]  ali follow..  24  1.MKKIIVTTCLLATGFLLTACGESQSSNESQQTT........................................................................................................ 33
59 -14.800IDP05480 putative lipoprotein [Bacillus anthracis str. Ames] BA_3532 [Bacillus anthracis str. Ames]  ali follow..  23  1.MKKKLTILFSIVCILVLAACGQTKANKEETKKVMSQKS................................................................................................... 38
60 -14.700IDP92716 sugar ABC transporter substrate-binding protein [Streptococcus pneumoniae D39] YP_817037 [Streptococcus pneumoniae D39]  ali follow..  17  1MRKGTMLSVVAGLSLAILAGCSGGTNSKQASSSND....................................................................................................... 35
61 -14.700IDP91374 outermembrane lipoprotein [Vibrio vulnificus CMCP6] VV1_1919 [Vibrio vulnificus CMCP6]  ali follow..  20  1.MKNIGLLLLASLF---LAGCTTPTHLPLSGSQAIEIRIDDQFNPKH........................................................................................... 43
62 -14.600IDP05564 hypothetical protein lmo2431 [Listeria monocytogenes EGD-e] lmo2431 [Listeria monocytogenes EGD-e]  ali follow..  25  1.MKKITILMLSITAALLLASCGNDTTTDMNNETTKTENKSQAALTITDM......................................................................................... 48
63 -14.500IDP05001 putative lipoprotein [Bacillus anthracis str. Ames] BA_1090 [Bacillus anthracis str. Ames]  ali follow..  15  1.MKRVMYVVLLLSFVIGMTACNDETSSSRTLLSIGKPAKDNVIYFTHTDNKRK--------------------QEIQDMFQNKKWKRNETFSTVNKTPDVVFSIDEDNTGLPALYVTVYFHEDGADVLNLYGEYTSFN 118
64 -14.500IDP91975 ABC transporter substrate-binding protein - glutamine transport [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100009843 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  27  1.MKKWMLVLVSLMTALFLVACGKNSSETSGDNWSKYQSNKS................................................................................................. 40
65 -14.400IDP05245 hypothetical protein lmo2349 [Listeria monocytogenes EGD-e] lmo2349 [Listeria monocytogenes EGD-e]  ali follow..  31  1MKKKYGILALALTAALTLSACGGKEEPEAANQKVQTITVGTGTQ.............................................................................................. 44
66 -14.400IDP05050 iron compound ABC transporter, iron compound-binding protein [Bacillus anthracis str. Ames] BA_5330 [Bacillus anthracis str. Ames]  ali follow..  33  1MLLKLVSILAIFTLM--LVACSDSGKETSKATKDNSSDKPKTVEITDAHGKVK..................................................................................... 51
67 -14.400IDP04564 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1610 [Clostridium perfringens ATCC 13124]  ali follow..  16  1.MKKVSLIFIALSFALLFLGCGNNNEASRYSSTGDRDT.................................................................................................... 37
68 -14.300IDP92694 TpgX protein [Staphylococcus aureus subsp. aureus ST398] YP_005735174 [Staphylococcus aureus subsp. aureus ST398]  ali follow..  19  1.MKKLVTGLLALSLF--LAACGQDSDQQKDSNKEKDDKAKTEQQDKKTNDSSKDKKDNKD.............................................................................. 57
69 -14.300IDP02622 ABC transporter, periplasmic substrate-binding protein [Coxiella burnetii RSA 493] CBU_0109 [Coxiella burnetii RSA 493]  ali follow..  31  1MLKKLMRLLISGVMLVGLTACHQKEAKNE............................................................................................................. 29
70 -14.200IDP05694 hypothetical protein lmo2007 [Listeria monocytogenes EGD-e] lmo2007 [Listeria monocytogenes EGD-e]  ali follow..  35  1MKKKWGVIIASLCLLLGLSACGSDEKADANEVPT........................................................................................................ 34
71 -14.100IDP04242 sugar ABC transporter, sugar-binding protein [Clostridium perfringens ATCC 13124] CPF_1113 [Clostridium perfringens ATCC 13124]  ali follow..  29  1MRKKILSAILCMMIATAMVGCGDKTDSTQAKDGGKVK..................................................................................................... 38
72 -14.000IDP05612 putative lipoprotein [Bacillus anthracis str. Ames] BA_5233 [Bacillus anthracis str. Ames]  ali follow..  12  1MLKTIKNTLLFFLCLVVLSGCFTREGTIVGGKVHGGSNSIDGKYKSTGFATQDMDVKKGESWTFTFEDKTKQGTIKAYVLDSNDNTILEVNSGNSKNNIKV-------SKDDTYKVKIITEEHGGEFEISWKKE.... 128
73 -14.000IDP91956 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005733 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  1.MFKNFKKIAFTSSLILLAACSNNASNTNQSTDEGSVDKSQETNSASNGRADWLQTKASEQGYNLRLVDISGGELADRLIAEKNNAVADMVIGLNKLEFNRIKLLVKYSPKWADEVDSSLGDSEGYYSPIVNQPLVL. 143
74 -14.000IDP05695 hypothetical protein lmo2080 [Listeria monocytogenes EGD-e] lmo2080 [Listeria monocytogenes EGD-e]  ali follow..  26  2MFKKVILPVL--LVVLFLAGCNQAEVPALVLDGTITDTSLLENNNE............................................................................................ 47
75 -14.000IDP05525 putative sugar transporter, substrate-binding lipoprotein [Clostridium difficile 630] CD2550 [Peptoclostridium difficile 630]  ali follow..  27  8MLKKLCSLAMVAIMTTTITGCSSGNGKDSKKDGEKEK..................................................................................................... 45

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.