current user: public

If you have questions about the server, please let us know.

Query: IDP05615 putative lipoprotein [Bacillus anthracis str. Ames] BA_5522 [Bacillus anthracis str. Ames], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MFKKVFVPLFAATVLISGCNKEVVKESPKDKVEQHKKNTPLKIDEVKINTVNGKTLMVDVKAKGEKLTYAYYIYKGEEIVEKIWYKPENSLKYEVKEPGKYKVKAYAKDANKKIDSVYTNEVTIEKLast
1 -56.600IDP05615 putative lipoprotein [Bacillus anthracis str. Ames] BA_5522 [Bacillus anthracis str. Ames]  ali  100  1MFKKVFVPLFAATVLISGCNKEVVKESPKDKVEQHKKNTPLKIDEVKINTVNGKTLMVDVKAKGEKLTYAYYIYKGEEIVEKIWYKPENSLKYEVKEPGKYKVKAYAKDANKKIDSVYTNEVTIEK 126
2 -28.100IDP04348 two component regulator [Clostridium perfringens ATCC 13124] CPF_2547 [Clostridium perfringens ATCC 13124]  ali follow..  16  565.........YTIDIFARNIKCKEGFDSRREVRFYVSEALPITISTSDKVFKINEEINFSTKCEGGSVCYEYYIMVNGNWSLVQKYSRKSYYSFRPYVPGKYKVLVLTKSYYKKCAYEDYDTFEFK. 684
3 -21.700IDP05125 putative lipoprotein [Bacillus anthracis str. Ames] BA_4310 [Bacillus anthracis str. Ames]  ali follow..  13  1MKKLIMT-LFIAMLALAGCNTNKEEPKKE----QKLEAVKVAVQTNPKEIKPGEKTEVQALVTQGK-DVKFEVWKAGDEKHEMLEGKHKAVEKTFETDGVYHIIAHTNAREMHVMPEVKVAVG... 129
4 -17.600IDP05612 putative lipoprotein [Bacillus anthracis str. Ames] BA_5233 [Bacillus anthracis str. Ames]  ali follow..  14  1MLKTIKNTLLFFLVVLSGCFTREGTIVGGKVHGGSNSIDG-GFATQDMDVKKGESWTFTFEDKTKQGTIKAYVLDSNDNTILEVNSGNSKNNIKVSKDDTYKVKIITEEHGGEFEIS----WKKEK 129
5 -14.000IDP05418 conserved hypothetical protein [Bacillus anthracis str. Ames] BA_1561 [Bacillus anthracis str. Ames]  ali follow..  15  3INKWLFIGFLVMLVVITTLNSLNVFASVNDLAQPIASAKVIEVNPNVITIPINESTTLLLK-NKGKSEHTFTI-KKLGIDVVVESGKEKNITVKPKSAGTYELICRYHLLKGME------KVIVK. 129
6 -13.700IDP05407 conserved domain protein [Bacillus anthracis str. Ames] BA_1485 [Bacillus anthracis str. Ames]  ali follow..  1MKNLVIGLVALLFVVVGGFYIKKYQETTE------TVGDVQEVKWDVSNGKGNEKADIVFQLLNNKQIRAVIVDGQLKHVQQTKPTFAGKVSSKIAKDEGYTIFLYEDKNKSVQSFAKK....... 126
7 -13.300IDP05700 hypothetical protein lmo2467 [Listeria monocytogenes EGD-e] lmo2467 [Listeria monocytogenes EGD-e]  ali follow..  15  276................NKSTLSNSINVTTKEVPAVDNEAPTAPKSLMSHGQTDTTIALCWQASTDNVEVKYEIYRNNTKIAT---STKTMFEDTKLASNTYNYKVYAVDTSGNR-SLVSNEITIKT 383
8 -11.300IDP05411 putative chitin binding protein [Bacillus anthracis str. Ames] BA_2793 [Bacillus anthracis str. Ames]  ali follow..  18  280.........YSYTVKAIDAAGNASKESAKLTVKTTVEAPDTE-KGLHSMGTTTSSVDLMWSPSDDNIGVGYDIYRETEGSMKK--SNTTSYMDKNLLPNTYKYVVKAVDVAGNE-SVQSDIFTIT. 401
9 -11.200IDP05422 putative lipoprotein [Bacillus anthracis str. Ames] BA_1872 [Bacillus anthracis str. Ames]  ali follow..  17  1MKSLRLFMILTLVVLLSACNTATQVTKVQKNGETTLKIGSLQ--DVQTLKAEKGNVEIPYEAAVEEGTILLQVTKDDKVIYEEEITSQKELSFEASKSGSYDLIVRVKGEK-----EKAKEIQIH. 123
10 -11.000IDP05036 hypothetical protein BA_1663 [Bacillus anthracis str. Ames] BA_1663 [Bacillus anthracis str. Ames]  ali follow..  21  193................................KELPKLHKVTIDEMKGNVKQGDSIRVRVKATDVEVHVTLKGKENKEITFLLDYNKRDQKVFEITDSGTYELLVEVVDAAGNKLIEASE...... 294
11 -10.600IDP05412 putative microbial collagenase [Bacillus anthracis str. Ames] BA_3584 [Bacillus anthracis str. Ames]  ali follow..  15  744.........VNYRVNASGQFEYDVVFHGMNTEEGAVNKAPVAVINGPYSGNVNEAISFKSDGSGKIVAYKWEFGDGTV-------SNEQNPTHVYTKEGTYTARLTVTDDKGLTNTV-TTNVTVQK 856
12 -10.500IDP01744 gene: sinI; putative outer membrane protein [Salmonella typhimurium LT2] STM2516 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  1MQVKRRLTKVALALVVAGYADKTADTDKDHVTVTIDRGDRKIVTEGDKQFHVGDKVTVNWAIGDTEATVKWVSFSDQNGSDPKDLGTGDSYEIQAADADRY-IGIKITPTTTTGDPAVATELLLKD 175
13 -10.500IDP05757 hypothetical protein lmo0881 [Listeria monocytogenes EGD-e] lmo0881 [Listeria monocytogenes EGD-e]  ali follow..  12  2MKKKGYVLLIIALLSLTLAHAQKETTATTYTTATTSELMDMFLPYPIQNPYIETTKNSAELMFVTEEAASITTETNNQTQSIAGSTENHQFTLANLQPGNNLVTITATMADGTSE---SKTITIN. 129
14 -10.400IDP90353 gene: oppA_3; oligopeptide binding protein [Chlamydia trachomatis D/UW-3/CX] CT198 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  12  1MRKISVGICLLLALATSGCSKSSSNATHRSPATHTVKDDPRTFDPREVRLLSDINLIHHLFLSEDKKTYTFNLKKNGDLITAHDFVRSWNDVLQNRVASIYSFAFLIDVNKDFAKDDHTLVINLLT 159
15 -9.840IDP06418 gene: K1; K1 [Human herpesvirus 8] YP_001129350 [Human herpesvirus 8]  ali follow..  76..................CVGQSGHRYSLWITWYAQPVLQTFCGQPSNTVTCGQHVTLYCSTSGNN---VTVWHLPNGQNETVSQTKYYNFTLMNQTEGCYACSNGLSSRLSNRLCFSARCANIT. 179
16 -9.580IDP02418 fibronectin domain-containing lipoprotein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1279c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  10  298............YYKVTMVDKDGLESPMPKDGVEGKTLGNPLAPSIILAQSTSEGINLEWSDNDTRAVYEVRRYGGEQNAVFKGIKEKRLKDVKALPGVEYSYEVIAIDSAGLR-SEPSSKVKAAQ 411
17 -9.520IDP04392 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1500 [Clostridium perfringens ATCC 13124]  ali follow..  15  1MRVLKGVILAIIPAFLFMGCGEFSKNDVAKVSFEKLSEKEEQILNLTDNRVFFYKVKNISKNKGYRIDLNYEVYKEGKEVKNEP-KGKENITLGINFKDDNRINCLLGGDGAYSRHNYKAEENIKD 135
18 -9.500IDP02563 collagenase, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA3299 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  739.........FVNYRVNAANQFEYDIVFHGVATEEKEKTNTIVNMNGPYSGIVNEEIQFHSDGTGKVTSYLWNFGDGTT-------STEANPTHVYEEKGTYTVELTVKDRRGKESKE-QTKVTVKQ 851
19 -9.360IDP05162 hypothetical protein BA_1701 [Bacillus anthracis str. Ames] BA_1701 [Bacillus anthracis str. Ames]  ali follow..  14  109..........TVYVSVQSKDQLESPRTAKKYDTQVSLAPAVKNIVILNNDDADDIVRVTGLESGDVVKV-YGEATGGEVIEKATVQGNKTAVNVKIPQEAGKVYVTVTKPNKDESKRVGKDYIAE. 225
20 -9.060IDP91954 oligopeptide binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100003495 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  16  1MKSSRLFALAGVTLLLAACSGSGSSTKGEKTFSYIYETDPDNLNYLTTAKAATANITSNVSVSKDGLTYTYTIRKDAKWVKAQDFVTGLKYAADKKSDALYLVQESIKGLDAKGEIKDFSQVGIK. 162
21 -9.050IDP05363 hypothetical protein BA_2032 [Bacillus anthracis str. Ames] BA_2032 [Bacillus anthracis str. Ames]  ali follow..  11  1MKKFIGMLAMCFALTLAFLPTISKADSSPLRSVSISAVGD-ASSYLTIPVLKGDYLYVKVSEVGTPDSYSETLTINGVRYAGSSLDEVSSYTFSNTPNSTNTIAFEARVPFSMQVLSKNISVHVE. 148

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.