current user: public

If you have questions about the server, please let us know.

Query: IDP05708 hypothetical protein lmo2839 [Listeria monocytogenes EGD-e] lmo2839 [Listeria monocytogenes EGD-e], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MKKKSLVLLVVVLVLSAVLAACGGKESGSKEVTIEFMHSSVEKERLDVINKLIADFEKENPTIKIKQIPVEEDAFNTKVVTLARSGKLPAVMEVSQDFAKVMDKDELIDQDAVKEVIDSVGEDKYYEGATNLVRSEDGKSYIAAPLSGWVQGIWYNKKALADAGFEEPKNWADIEKVAKKFTNKADKKYGIAIPTAESTMSEQAFSQFALSNKANVLDAKGNVTIDTPEMKEALQYYKDLSAYTMPGSNDVTEIKDAFMNGTVPMAMYSTYILPSVYEEGDPKNIGFAIPEEKEKAVYGTVSGLTISAGLDDEQKKATKKFVEYLSQPENMATWVLMSPGGAQPVNKEVVEQKAYKENEVIKSFGDLPNEIAASFNDIQVFGLVDGKNLTKMGDITSSGIIAQMVNNVTVGGGDVSADLKAAQKKAEEGKLast
1 -123.000IDP05708 hypothetical protein lmo2839 [Listeria monocytogenes EGD-e] lmo2839 [Listeria monocytogenes EGD-e]  ali  100  1MKKKSLVLLVVVLVLSAVLAACGGKESGSKEVTIEFMHSSVEKERLDVINKLIADFEKENPTIKIKQIPVEEDAFNTKVVTLARSGKLPAVMEVSQDFAKVMDKDELIDQDAVKEVIDSVGEDKYYEGATNLVRSEDGKSYIAAPLSGWVQGIWYNKKALADAGFEEPKNWADIEKVAKKFTNKADKKYGIAIPTAESTMSEQAFSQFALSNKANVLDAKGNVTIDTPEMKEALQYYKDLSAYTMPGSNDVTEIKDAFMNGTVPMAMYSTYILPSVYEEGDPKNIGFAIPEEKEKAVYGTVSGLTISAGLDDEQKKATKKFVEYLSQPENMATWVLMSPGGAQPVNKEVVEQKAYKENEVIKSFGDLPNEIAASFNDIQVFGLVDGKNLTKMGDITSSGIIAQMVNNVTVGGGDVSADLKAAQKKAEEGK 430
2 -115.000IDP06544 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09718 [Enterococcus faecium DO]  ali follow..  70  1MKK--IIVTTCLLATGFLLTACGESQSESQQTTIQFMHSSVEQERLSVINELVADFEKENPDIKIKQVPVEESAFNTKIVTLARSGKLPEVMEVSQDFAKVMDKDELIDQTAVQNVIEEAGEDNYYDGAKNLVRSEDGKSYIAAPISGWVQGIWYDKEKLSEAGFSEPENWDDILKIAQHFTDKENKQYGIAMPTAEGTMSEQAFSQFALSNGANVLDDEGEVTIDTEKMREALSFYQNLSQYTMPGSNDVTEIKDAFMNGTAPMAIYSTYILPSVYEAGNSENIGFAIPTQKDQAVYGTVSGLTISSGLDEKQKEAAEAFTAFLSQPKNMEKWVLMSPGGAQPVNKQVVELDGYKENEVIKSFGELPSEIASAFDEVQVFGLVGEKNFTKMGDITSSGVIGKAVNQVTVGNEDVDQALADAQKNTK... 427
3 -88.100IDP05433 hypothetical protein lmo1730 [Listeria monocytogenes EGD-e] lmo1730 [Listeria monocytogenes EGD-e]  ali follow..  19  1MKKKMFVVLALVLSLSLVLMACGGSKDSGDSKVLNVWAM---GDEAKSLKELAQKFTK-DTGIEVKVQVIPWANAHDKLLTAVASKSGPDVVQMGTTWMEFVEAGALLDITKDVEKSKNMNSDLFFPGSVKTTQFD--GKTYGVPWYAETRVLFYRTDLLKKVGYNAPKTWDELSDAALKLSKRGKDMYGFAIDPNE----QTTGFIFGRQNGSPLFDKDGTPVFNKKPFVDTVTYLDSFIKNGSAPDTGLDASQSFGGDGIVPMFMSGPWMVNTLKDTAPDIKWATAVLPKKENNE-SSLGGANLSIFKYSDKKDDALKFMDYMSQPDVQLSWLKDT--NSMPARMDAWEDDMLKNDPYYKVFGEQMKTAEPMPLIPQFE--------------EIAQLYGKSWEQIYRGGADVQTQMDTFNDQVETL. 411
4 -87.800IDP05444 hypothetical protein lmo0768 [Listeria monocytogenes EGD-e] lmo0768 [Listeria monocytogenes EGD-e]  ali follow..  19  1MKK--VLLAILSMVLLLSLAACGGSSDSNGKEEIVMWGSW-SGDQIKQLEKQIDSYNKSQDKYKVKY--VMQENVEEKLLTGIAGGELPDIIMWDRYQTLYAPKGVLEPLDKLVKE-DNLKMDDFYEESVKEMTYS--DKLYGLPLLNDNRILFYNKKLLQEAGVKPPTTWDELATAAQKTTKWDGNKMTQA---GMSLQDVGLFNLYLMQAGGELVTSDNETAFNSEQGLEVLNYWDKMQNDLKVYQRGFDDGSDAFAAGKEAMTYNGPWALADYNKVEDLDYGVVEPPKGPNGDKGAIMGGFGLVMPKQAEHKDGAWDFMKWWTTPENGVEFAKIS--GWLPANKIAAEDEYFTKDPNYSVFVNTMKYAKIRPTVAGYADV-------------EGLAMKPQFEKFMNGNISAEKALSQAEKEGNQI. 410
5 -86.000IDP95187 gene: lmo0181; lmo0181 [Listeria monocytogenes EGD-e] CAC98396 [Listeria monocytogenes EGD-e]  ali follow..  20  1MKKG-LLLLMVVVLSVFGLSACGGGSSSGDKTEITYYQ-FSAPADGKALDEMVKEFEKQNPDIKVNVQTIAFNDYFTKLQTQIAGGDAPDAFELNYEFMQYAEKGVLADLTSYIEKDKDFDPSTLNKQAYDAFKYD--GKQYGMVESFSNVVTIYNKDLFDKAGVEYPTTWKDEEAAAKKLTDAKNKVWGTSQPVT-----MNEFYKVAAQNGGSIFNEDLETTINSPENVEALTHLTNEVTDSKVAPSSGQLPEDLFMNGQIAMLHTGIWLFDMFQDA--PFKWDVQVEA-GNTQKATHFFANGIGVSKDSDKKEAAFKFASFMSANEEAAKIRIDN-NWELPATENKEILQPYLDPDNREAVFESLQYMVLPPVVKDWN--------------KISDYTNSEFEKVLNGDSTPEKALKNSEDNINKT. 414
6 -84.700IDP05674 hypothetical protein lmo0859 [Listeria monocytogenes EGD-e] lmo0859 [Listeria monocytogenes EGD-e]  ali follow..  17  1MKRKIAIAALSVVVAGSLLTACGGGNSDNGKTKVTFWAA-PNPTQVKYWDEMAKAYEKENPDVTIEVSQMKEPSSEATIQSAIASKTAPTMSENRSFAAQLADSKAIVPLNDVKGLDDVVKERNMSETMDSWKFSD--GNQYVLPVYSNPILFAWRLDTLKELGYDPPKTYSEALEVGKKLKAKYPDKVLWAKGDLSDPTAFDFFPLYDAASKGNAFVEDGKLVADDKAGTELLTFMSELQKNKLLLA---SKATDPFETGTSIMADNGPWTFPNWDEKFPELKYNVPDSMVNEENVATYADSKGVVMYATDKEKEAAMDFLKFVYNDDKNDL---LETTNLIPARDDATENETFKENPELEVYAANVPYSIPAMDDAKYNDIQ-------------QIIGEEAWNPIVRGEKKPTKAWSDMKKAEDGV. 436
7 -84.600IDP05525 putative sugar transporter, substrate-binding lipoprotein [Clostridium difficile 630] CD2550 [Peptoclostridium difficile 630]  ali follow..  16  8MLKKLCSLAMVAIMTTTLITGCSSGNGDGEKEKLVLWMPPVENNMKEVWDPILDKFEEKN-NCEVDLQIIPWDNYSEKFATAISAGEGPDVGYMYAEMYQFIESGAVEDLTNYAT-----KEDKEQSIYIKTSEMM--GGMYGMPFQANPGVLYYNKDILEKLGEKPPKTWEDFKRICKKATQDTDGQWGLAQGWGAKTFGNWNWYPYLWQAGGDIFNDDLSVKFNDKSGLEAAKFLKELQAYVPEDSDSNEMIESVFGPGKAAFTIMLSSAATSVFDESPDLNWGFVTGL-EDKKAATFGAVDHLSLMSSAKNKELAYKLIQHMLSVESMTEFHKAI--PRAPITKGEPYQ---GDERFKEMVENDKNVYRPLVVGPHGV--------------EIYEYLWKELQTMISGDKTPKQALDDAAKYSNDL. 427
8 -82.900IDP06508 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN10305 [Enterococcus faecium DO]  ali follow..  16  1MKGKKWLIGSLLVAATGILGACGGGSSSDKEVTLTFWNGF-TASDGEILQEIVNEFNKTNKNIKIEMDIMTWANLNEKLPTAISSKKAPDFIALNYPFAQYVENGAVQPLDDFWEY-DGVDKSDFKETAIELGEVE--GKQYFVPMQVQGMYMYWNNDLFKQAGLDPPTTWEELTEMAPKLTDSSKNVSGFVFNKD----GTAPLYNWMLANGGKLVNDDYKSEFASPENLKTLKAIQKMIHVDGPESISGAEMDNLMNAGQLAIEINGPWLNNGLKANEIDYNVTTLPQGSDSDKKTAILDGVGYAIPASTNKKEAVYEFLKYWNTTEIGKKWSIEN--GFPAYLDSVAKDEEVKNDPIVSELSKQMDYAEPYLPGFTQIS-------------AINNDIINPLIEKLLAGEDPETLMNDADDAINQL. 420
9 -80.600IDP91953 extracellular solute-binding lipoprotein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100002215 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  18  1MKFRKLACTVLASAAVLGLAACGNSGGSGAKTEITWWAFKTGDGVGTYEKSIIEAFEKANPDVKVKLETIDFKSGPEKITTAIEAGTAPDVLFDAPGRIQYGKNGKLAELNDLFT--DDFVKDVNNENIVQASKAG--DKAYMYPISSAPFYMAMNKKMLEDAGVAEGWTTDDFEKVLKALKDKGYTPGSLFSSGQGG--DQGTRAFISNLYSGSVTDEKSKYTTDDPKFVKGLEKATGWIKDNLLNNFDGGADIQNFANGQTSYTILWAPAQNGIQAKLLEAEVVEVPFPSDEGKPALEVNGFAVFNNKDDKKVAASKKFIQFIADDKEWGP-KDVVRTGAFPVRTSFGKL---YDDKRMETISSWTQYYSPYYNTIDGFA-------------EMRTLWFPMLQSVSNGDEKPADALKAFTEKANET. 435
10 -78.000IDP01422 glycerol-3-phosphate ABC transporter, periplasmic glycerol-3-phosphate-binding protein VC1549 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  1MNK------VWLTGLLTATASGVFSASTLAATEITWWHAM-GGQLGETVNQLATDFNASQSDYKLTPVYKSYTETLTAGIAAFRAGQAPNILQVFDAGAAMSSKGVAKPVQDLMIESGPFTAQDYIAGVRNFYADNTG-KMVGMPFNSSTPVLYYNKDMLASVNAQAPQTYEQLEQVAAKLAEKGQAGFAQSLTPWIMFENFKSRHNLPLSDKQNGYQDLSKIMFNSDDMLMHVKKLKEWSDKGKYYGSDWDANQTPFERGEVAMWMGSSGSFGGLRNRV-KFNLGTTYLPVTKNPTHTFIGGAALFALQTPAQDKGVAAFFAYLTKPETQMNWHKTT--GYVPVTNAAYDLTKYQENPDAEVGVKQLSLPDGEWTKGYRLG----------YYPQVREVMHREFDNIFSGRSTVESSLNKVEDESAKL. 425
11 -77.900IDP05761 hypothetical protein lmo2125 [Listeria monocytogenes EGD-e] lmo2125 [Listeria monocytogenes EGD-e]  ali follow..  17  1MKRKKVGIVSAVLVMALSLAACGGGKDSSDEKTLTVSV---DAGYKDYVNKIKGDFEK-DNDVKVKVVEKDMFETLEALPLDGPAGTAPDVMMSAFDRISLGQQGHLAEVKLGNK-------DDYDEKDQKQVTID--DKIYGAPAIIETLVLYYNKDLLDKA----PATFKDLETLSKDSRFAFTSEKGKNTGFLAKWTDFYFSYGLLAGYGGYVFGDEGDIGLNNKGSVEGITYATKWFQDVWPKKSADDFIQDQFVKGKAAAILGGPWSAANYKEAKINYGVAKIPTLNNGKEYSPFAGGKGWVVSNYSKNKDVAQKWLDYVTNQKNQETLYDMT--NEVPANLKARDTAKSKNDELTNAVIEQYKNAQPMPNIPEMS--------------EVWTGAENLMFDAASGSKTPQQSADDAVKVIEDN. 412
12 -77.900IDP06507 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN11122 [Enterococcus faecium DO]  ali follow..  18  1MKKNRIVMMGVALVSGLVLAGCGNGSSNSDKVELSINYYNG-----AISKKAMDNAKKEFSDYKLSFKQIPADDFDTKLKASLNSKSAPDITAINSNISDLPYADKFVNLLDYDS---ETLAADFVEWKWDSCFTNDKKTQIAMPIDIGPTALFYNVDAFAKAGLPTNKDEESLMAAAKQMKEKADMPFF--------QSSLSLLQSKNRTMTEHIYDENGKLTYANGQLKEIWDYAVKAEKSGYTLGTKSADGANSVQKGMFGGMIEASWGINDLAENGVSPQWMIAKSPFT----ASNYGGSYLAVIKTSSHPKEAAEVVKYLTNEDSQRANYEEL--ALFPSNTKVYDDSFFGDEEFNHYFIDAANELEYVPSDPRES--------------AAFKCFEDQIILVAEQGKDPEKAWNDAVKKVEEM. 415
13 -76.800IDP02597 putative sugar binding protein [Yersinia pestis CO92] YPO3472 [Yersinia pestis CO92]  ali follow..  17  1MKTQMIMSKVKIKSLLLLTYLAMGIPSLHAAETLQVWIR-ASNDSKNIYKKEADTFEK-KTGIKIEYFNAT-TDFEQRLARAAAGNALPDLIFNDAVAIQFVQLGIVEPIEPKNIIGG---ENIFDTAWKSTQYID--GKYYGVPTSAQTFALFVRKDWREKLGLEQPKNWQDISTLAKAFTFNDNDTYGFILPGSTRGYASWFISSYLWQAGGDFIRPAGEASLEEPAATETLSFMRGMVCDKTVQPGTTADAIPSFRSGQSGMFFSGPYHIALFDKDPGTEAFEVIPPPTGPKGQATLAEGTTVFMMKSSQKKAAAQKFIEFMISPEGQQIGMGMG-TKNMPVVRLSINKKAVYDDPRWAIFADLYAEQGRYIPQVPNWT-------------PIRQVTAEGFNRILANDSDIAAELKAVNQKVNDE. 428
14 -76.800IDP02207 putative sugar binding protein [Yersinia pestis CO92] YPO0612 [Yersinia pestis CO92]  ali follow..  12  1..........MKILYYIAIAIASL--PLMAAERLEIMVP-SGSYVSFMRNTVTPEFNKLYPEVNLVVS------NDEQLDTRMAAGDNPNVYIGVFGYAKLAKLGKLAYLDKFPGFAE---NERIDPHFLREN----FGRTYYIPWNATTQMMIYNKELFAEAGLDPPATWDEFLLAAEKISALPPRVYGTVFWNDVLSFGSWYMYYNVNQGQYQLLNRYGTDIVFDRPDANMAQFMRTMQQAQRFAP---LTMEKSFFSRNIGMWLQFGFGWKATLSSAAERDVAIAPIPTKGDIHYSVLDGRAIMIFKDARKEQLSWALLNLLMRDDINLQANIAL--GQLPTLKALQDAPYF-QSAEAQPFVQQLQHAILSEPFANAMEV-------------ANIILANYSKVVLKGEISPEQAVATSAQAARQL. 410
15 -76.400IDP02726 maltosaccharide ABC transporter, maltosaccharide-binding protein, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA4229 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  17  1MKKA-LSLLTVSALSIGMLSACGPKDSGKKDYDLLVWE---DDKKGVGLEPAVKSFEEKY-KVKVKVVEMQMTDQVKKLRLDGPAGTGPDVVTLPHDQINAVTEGLLSEVKA-----DDAVKSKFTDSSIEAQTYN--GKLYGLPKAIETPVFIYNKKLMPKA----PETMDELFNFSKEFTKD--GKYGFLALGDN----FYFANAFMAGMGGYVFGEKDDVGLNNSGAVQGAEYLQKWYKEKLFPKSGGPAADGLFNEGKAASIMNGPWAFQAMEKNGIDYGVAPMPKLPNGQPLKTFVGVKGWHVTSFSKQNDLATKFTEWVTNEENAKIRFEKT--KEIPPVKAVMEDPIIKDNEAAKAVATQSENGIPMPNIPEMQ--------------EVWKPAGDALQLVVTDKEAPKAALDSAVKQIKGN. 410
16 -75.400IDP92716 sugar ABC transporter substrate-binding protein [Streptococcus pneumoniae D39] YP_817037 [Streptococcus pneumoniae D39]  ali follow..  17  1MRKG-TMLSVVAGLSLAILAGCSGGTNASSSNDIKVWVQSDETNEGKAWQKVVDNFNQSGSKYKVVTEYIPRGGYEDKVNAAITTNSLPDVITLDPNTAAYAKSKVITPLDDYLKDNN---MDDVLDSIKQQGTYN--GKFYAFGFSESNVGVYYNKKMFKEAGIAEPWTWDEFNTIAKKLKDHYNKPTIDFRINSNDEMLPYAYMPLIWSNNGSVVNEDGTKAFNSKESVEAVQFIQNLVKEGYTTV---SPVEKGFETGEYPMLLSGSWTIADMNTNYKDIDFGILPYPSKTKKLVSPSGSWQLAVTTKSDKKEAASEFVKFATNTESSEIISLGN--SVLPIRKSTIENIKDVSEPMRFLMEQNSKTAHARPVVVAYP--------------QVSRAFQQAMQDISYYEENPQKVLDTRTKEMQTA. 430
17 -75.000IDP91126 extracellular solute-binding protein, putative [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00176 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  13  1MSKI-LKCITLAVVMLLIVTACGPNRSKDKPNQLTMWV--DGDKQMAFYKKITDQYTK-KTGIKVKLVNIGQNDQLENISLDAPAGKGPDIFFLAHDNTSAYLQGLAAEIKLSKD-----ELKGFNKQALKAMNYD--NKQLALPAIVETTALFYNKKLVKNA----PQTLEEVEANAAKLTDSKKKQYGMLFDAKN----FYFNYPFLFGNDDYIFKKNGQLGLNSKHVVKNAERLQKWYDKGLPKAATHDVMIGLFKEGKVGQFVTGPWNINEYQETFGKDLGVTTLPTDGGKPMKPFLGVRGWYLSEYSKHKYWAKDLMLYITSKDTLQKYTDEM--SEITGRVDVKS-----SNPNLKVFEKQARHAEPMPNIPEMR--------------QVWEPMGNASIFISNGK-NPKQALDEATNDITQN. 409
18 -74.300IDP04377 putative maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein [Clostridium perfringens ATCC 13124] CPF_2652 [Clostridium perfringens ATCC 13124]  ali follow..  16  1MGKRLATVMAATMLFAGSLVGCGGKSDSGSGKELTVWSHL-TTPEVEELNKMASKWGEENG---VKVKVVEDKSEMQAYIQAANSSKGPDIMFGHDNLGTFQKAGLLAEVPEGIIN----DSDYASHQVLDAVTID--GKRYAVPIAQETSALFYNKDKVKEV----PKTMEDLVKVAEEGAGFKYDINNF-----------YATYGFIAADGGYVYKDNNDIGLGTPGAIKGYQFVQDLVQKDMPADITGDIAKGDFLSKNTGFYISGPWDVSAFKDGGVNFGV-APMPTLFGKQVPTFLGVQTAFVSEKSQNKDLAWKLVKYLSENSGDVLL---NKGNRIPVLNKYLDSADFKNNEYMSAFAEQAKFATPMPNIPEIQ--------------AMWGPAGANLQLLTSGQVTPEKCAEMTVEQIKQG. 403
19 -74.000IDP01500 gene: malE; maltose ABC transporter periplasmic protein VCA0945 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  6TQKDMNMKNALSTVALSTLVALGGAHAAIEEGQLTIWI-----NGDKGYNGLAEVGKKFEADTGIKVTVAHPDALQDKFPQTAATGDGPDIVFWAHDRFGYAEAGLLVEIKPSAKI-----QEGIVDFAWDAVKYN--GKIIGYPIAVESLSLIYNKDLVPN----PPKSWEEVAELDAKLKKE--GKSAIMWNLKEP----YFTWPLMAADGGYAFKYGKDAGINNKGVKDAMNFVKGLVDKGISPDMDYSVSESAFNQGNTAMTINGPWSWGNIEKSGINYGV-TTLPKFNGQASKPFVGVLTAGISTASPNKDLAVEFIENYLLTNDGLRMVNND--KPLGAVALNSFQRELDADARIAATMDNAMNGEIMPNIPQMNAF---------------SSAKNAIINIVDGRQTVDAALADAEKQMTK.. 406
20 -71.400IDP06546 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09092 [Enterococcus faecium DO]  ali follow..  17  1MNRKLIAGVVCLAAASGFLTGCGSASTADKEEKVTVWA-WDETFNIKAVNEAKKVYENEETEIEVVT--MSQDDIVQKLNTALASGNLPNIVLIEDYRIQGYLTSY---PDAFANLSAIVKEDHFAPYKFAVNKV--GDKIYGVPFDSGVTANFYRTDLMAEAGYTEELKWDEYIQVARDVKEKTGKKIAEVNPSDLG-----RVRMIMQQAGEWYTSEDGETIQDNASLKYGLELFATLLKEDLVEQTDWNAGVTAIQSGAVASSPTGAWYSSTIQGAENQSKWKIAPIPNLQKAQASNLGGAGWYVIKGVAGEDSAKDFLEATFASNEELMGTLAKEIGLVSTMLSANEQEAYQEQKIFDDFSTWTSEIPEVNYGHETY--------------AIEAVVAEALHRIINGE-ETDKVLADTQKQVEAQ. 425
21 -70.000IDP06519 extracellular solute-binding protein, family 1 [Enterococcus faecium DO] EAN09962 [Enterococcus faecium DO]  ali follow..  15  1MKKRKLVIALLNITLLFSLSACGKTNEEKKATTLEVYVA--NGKLTNYVENAAKIYNRKGANIDLKIVNVASGTTVQMITPKLVTHDMPDIISMADTSAAGVLEDAFYSADEYGFYDK---GDQFYDQKLNILRQQTNETIIPWASDFTPALCYYQPKKFAEIGVEEISSWEEYIQVAKALKEKTGSFG-----ALPESGDQELFINMLAQQNQSLLDEEGNIRLNTKEAKHAAKLIKEMIDSDIVHFYG--AQDAEKAFQESAMFVAGGWYATNMSLNFPDAKWRMAPLIKENPGKGAVSGGSSFYVPKDAKNPQVAQQFLTFMLTDEECLANALEL--GVATSNSLAYQTEAAEKKF....................................................................... 372
22 -69.800IDP04242 sugar ABC transporter, sugar-binding protein [Clostridium perfringens ATCC 13124] CPF_1113 [Clostridium perfringens ATCC 13124]  ali follow..  15  1MRKKILSAILCMMIGATAMVGCGDKTDSGGKVKLRMTNWNNE----DTMKDMLKYLSEKLPNVEIEYQFIDNSNYNTIVDTQLSAEEGPDIICEPASALKHAKLGYLENVNDLA--------KKYSDSGTNVYKYD--NNVYALPGISWFEGIYYNEKLFEENNIQIPKTFDEYIEVCKKFQSL--GIKPLAAGLKSWEPLLKNSMAFVTAAGKNFGQEEGKVKLD-GTWNMYLDKWSEMIKDGIYTKDDHDQALEEFATGKAAMYCSGPWDLEAIMSKNPDLKLNMMPFYGTKPSDGWLIGGCGFAVNSKSKNKDAAMEVLKAISTEEGQKALWENNQG------SSYLTGTSFTLPEAFKGAEKAINAGHIYCPWNEWG------------AGSAHVDYGKQMQNYLLGNQDLKTTLSNVDSAASELI 417
23 -66.800IDP04058 ABC transporter, solute-binding protein [Clostridium perfringens ATCC 13124] CPF_0556 [Clostridium perfringens ATCC 13124]  ali follow..  15  1MKRKMLTVACVTAIAASAFVGCGNKEEAGEKKVLEIAVFEGGFGK-DYWDACIDAFEAEHPDVEVKMEANP--KIGDIIRPKLSSENTPDFIYLSTNANALIKDKALVDLSDVFDREDPDNLPGFLDTPLTTPYGD--GKVFLAPLYYNVTGMWYNKALFKEKGWEVPKTWDEFFELGKKA--KDEGIALYTYQGQAPGYNEAVIFPMLASAAGE-IFNYEEGAWKDPNVKKALDVFQRMADEDMVLNMTHTQAQVEFLNGKALFLPCGSWLEGEMKDAIPEFEFGFMAPPKEGDTPYVTTTIEQMYIPAKSDQVELAKEFLAFQYTDAMVQKNAEIA--KAVVPVKGAVEKAKSSLDASGYESYKFVEEGAKPIPLSFKPTNSKLD--------FRNDSLFGPVGSIINKELTVDEWINNLESDSQTLA 456
24 -45.100IDP05694 hypothetical protein lmo2007 [Listeria monocytogenes EGD-e] lmo2007 [Listeria monocytogenes EGD-e]  ali follow..  12  1MKKK-WGVIIASLCLLLGLSACGSDEKADEVPTLKWYMIGTPQKDTEEVMKEVNKYTEEKIGVKVEMTQIDWGDYGKRMQTVINSGENFDIAYSAAEFVSYSQKGAFLPLNKYLDKEGKKMKAELNDVLWEGATID--GNIYGVPSNGEQQVYVFNKNLVDKYKMDVTKNFSDLEPMLKTIKENEPSITPIGGNKDFKPAFPYDYLIDNAVPLPNQYEDTGKIVYEQPETLDILKSLHSFYQKGYVTKDIATSTDPWSYDKENWFVRIEKYQAENIWDKNTGGKYKVVTQPIAETPKNNSVTGAIQAVSVTSQHPEEAVKFLDLLNTDEYLRNLVKELDDGKIQDLPARVERYLKLYEDEPADKWDQFKEFNKKSVASPGLGFYFDSSKVRTEIASITNVCNEFAPALLTGTVDPVEYTEKFKAKLNDA. 464
25 -44.500IDP92625 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19F] SpneCMD_010100009638 [Streptococcus pneumoniae str. Canada MDR_19F]  ali follow..  14  1MKKKYAFASASVVALAAGLAACGNLTGNSDKPVIKMYQIGDKPDNLDELLANANKIIEEKVGAKLDIQYLGWGDYGKKMSVITSSGENYDIAFAD-NYIVNAQKGAYADLTELYKKEGKDLYKALDPAYIKGNTVN--GKIYAVPVAASSQNFAFNGTLLAKYGIDISTSYETLEPVLKQIKEKAPDVVPFAIGKVFIPSDNFDYPVAGLPFVIDLEGDTTKVVYEVPRFKEHLKTLHKFYEAGYIPTSDTSFDLQQDTWFVREETVGPADYGNSLLSRVANKDIQIKPITNFIKKNQTTQVA-NFVISNNSKNKEKSMEILNLLNTNPELKNWEKIEGKENRVRVLDGYKGNTYINENVTDQQIENSKKELAEAKESPALGFIFNTDNVKSEISAIANTMQQFDTAINTGTVDPDKAIPELMEKLKSE. 469
26 -44.200IDP04378 extracellular solute-binding protein [Clostridium perfringens ATCC 13124] CPF_2335 [Clostridium perfringens ATCC 13124]  ali follow..  11  4FKKLIALTACAMLTTSVALTGCGADKTANETVKLTWYTIGQTPKDLDMVQEKANEYLKEKINATIDMKFIDYGDYTQKMGVIINSGEPYDLAFTCNPYLENARKGAFLEIDELLETKGKEMKSVIDERFWEGAKID--GKTYAVPNQGVAPMWVFTKEYVDKYNIPYQHTLEDLEPWLKVIHENEPDVTPLY--ITKGFSAPAYFDQLVDPVGVEYGDESLKIKFETDKMKSELETLQKYYDAGYINTAKDDKAVKRFVTKADGQPYADGLWSKDLGYE-------VSSPIMDTHITNGSTTGSMIAISKTSEHPEKAMEFLNLLNTDVYLRNLLEKTSDTQIKLTDKAKDYSTYTLDNEPVDKWKEFEAFNDASVESPALGFKFNTEKVSNQIAAINNVLEEFKATIYSGSVNEAEYLDKMNKKLKEV. 460
27 -43.900IDP04240 extracellular solute-binding protein [Clostridium perfringens ATCC 13124] CPF_1077 [Clostridium perfringens ATCC 13124]  ali follow..  10  4RKKALSLILSGIVCSSLILTGCGNSKESKETVNLTWYVIGDEPADNDIVEEEVNKYLKDKINATVDIKHIPFGDYTKKMSVISNSGEPYDLAFTCSPYLEYARKGAFLELNDLLDTEGAPLKKEINKELWKGAEID--GKIYAVPNQALAPMWVFDKELVEKYNIENIHSVNDLEPWLKLVKEKEPDFIPFY---TQGDSIPLDFDDIVNPLGIFYNDKNLTVTFESKEMKDMLLKLREYYEAGYINQTDMKPEVKRFVWKADGQPYAENIWGKSLGREV------VTSSIIPPYITNNSTTGAMTAISANSKHPKKAMELLTLVNTDTNLRNLLEKINDKQIKKFDGKKYDVTYVSENDPIDKWEAFEKFNNSAKVSPILGFKFNSENVSNQISAINNVLQEFERALYTGSIDPEVGLNDLNKKLNDS. 456
28 -43.500IDP04329 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1466 [Clostridium perfringens ATCC 13124]  ali follow..  10  4NKKLIALLLGGIIGTSSILAGCGSGGSASKPVNLVWYVIGKPQNDGELVEEEVNKYIKDKINATVDIKHIDFGDYSQKMNVIANSGEEYDLAFTCSPYLDNARKGAFLELNDLIDSHGKDLKNVIDERLWKGAEVD--GNIYAVPNQAGAPMWVFDKELVEKYDIPDIHSVDDLEPWLALIKEKEPDFVPFY--TQGDGIPIEGIEDITSGLGIFYDDKSLTVKYETEELKHLFTKLREFYEKGYINQSNMKNEVKRFVWKADGQPYAENGWSQSLGRE-------VTSSIVSSYVTNASTTGAMTAISATSKHPEKAMELINLVNKDSTLRNLLEKVSDNQIKRDPNGPYSVTYVLDSDPVDKWDAFEEFNQKAKTSTILGFKFDTEKVVTQMSAVSNAFEEFIKPLYTGSVDTEETLEKLNKKLYDS. 462
29 -35.800IDP91964 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007935 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  17  1MKKTFSKSAVLLTASLAVLAACGSKNTASEKKTLKFMTASSPLSPKDPNEKLILQRLEKETGVHIDWTNYQ-SDFAEKRNLDISSGDLPDAIHNDVDLMNWAKKGVIIPVEDLIDKYMPNLKKILKPEYKALMTAPDG-HIYSFPWHSVNDMAWINKDWLKKLGLEMPKTTDDLIKVLEAFKNGDADEIPFTFISGNGNEDFKFLFAIGDNDDHLVVGNDGKVDFTNDNYKEGVKFIRQLQEKGLIDEHDWNSYIAKGHDQKFGVYFTWDKN----NVTGSNESYDVLPVLAGPSGQKHVFARDKMVITSVNKNLELTAKWIDAQYAPLQSVQNNWGTYG.......................................................................................... 388
30 -32.000IDP04248 ABC transporter, substrate-binding protein [Clostridium perfringens ATCC 13124] CPF_1477 [Clostridium perfringens ATCC 13124]  ali follow..  19  1MKKKILATLLTGLVLGTSLVGCGKTEGAEAGKKLVVSTWGLNEDVLK--ETVFEPFAKEH-GVEIVLDIGNNSERLTKMKN--NPNSQIDITYLAESFAEQGVEAGIFD----LDYSKIPNASEMNEKAKS-----TVEAGYGPAYTLNSIGIVVDPSA-----GIEINSWEDLWK--PELKNK------IAIPDITTTNGPAMVEIAAEKAGVDVKTDNGE---------AAFKELEALKPNVVKTYSKSSDLANMFSNGEIVAAVASDFAFGTISKAKPEVINVIP-------ESGTYLNFNTININKNSKNKDLAYEFINYALSKEVQEKTAKAL--NESPVNKEVKLSEEETKNLTYGPVVDNAKVI........................................................... 327
31 -29.100IDP04509 iron compound ABC transporter, iron compound-binding protein [Clostridium perfringens ATCC 13124] CPF_0440 [Clostridium perfringens ATCC 13124]  ali follow..  17  4.RKKLLALTLTALVSMGVLAGCGQKNQGSGEKVVNVY----SSRHYDIDKQLFKDFESDT-GIKVNLVDGKSDELIERMAREGDNTSADVFLTVGAENIAQLNEKDLI--------------KDISSEKINENIPSEYRGKNWVGLTSRARIIVYNKEKVNP---ETIKTYNDLTKDEFK----------VLTRSSSSSYNNALLSSFIQLDGAE----------------KAKEWAQGIVNNARTPEGNDRDQAKAIMAGIGDVGIMNSYYIAKMISSSDAEEAKVGKEIGVLFPENTHLNLSFGAVTKNAKNEENAVALLEYLTEEKAQKAYVDEN--GEFALNTKVGKSELQKSWGEFTV................................................................... 325
32 -28.900IDP00429 gene: sfuA; iron(III)-binding periplasmic protein YPO2958 [Yersinia pestis CO92]  ali follow..  13  1MKIPIPSIGHVALLASAILFASSANAASDEDGIIIY-----NAQHESFAKSWAEGFTKD-TGIKVTLRNGKDSELGNQLIQEGSSSPA-DVFLTENAMVLVDNAKLFAPLD-----------AATQAQVAKEYRPEDG-----TGIAARSTVFVYNPAKISEAEL--PKSLMDLAKPEWK---------GRWAASPSGADFQAIVSAMLALKGEQ----------------ATLEWLKAMKTNATAYKGN-STVMKAVNAGQIDGGVIYHYYPFVDQAKTGENSGNIKLHYFKNKDPGAFVSISGAGVLASSKHPQQAQKFVQWVTGKAGQDFLRESNSAFEYAVGVNAASNPKLVPLKDLDP................................................................... 316
33 -28.200IDP01937 putative periplasmic solute-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0727 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  15  1MSKKFFLSLGLVALLFSNSQAIDENKAAQAEGRVNSL---AMPDTWANWKDTWADLKNLY-DIEHSDTDMSSAQEIAKFKTEKKNASG-DIGDVGASFGEIAVKQGVAQ------------KTSYWDQIPTWAKDKDG---NWLLAYTGTIAFIVNKDVVKDI----PKTWQDLLKGNYK---------ITVGDVSVAAQAVSAVLAANYALGGDEKDLS-----------PALAFFNTLAKQGRLVNND--VSIANLEKGEVEVGLVWDFNGLGYRDKVGKDRYEVLIPADG-----SVISGYTTIINKYAKHPNAAKLAREFILSDKGQINL---AKGYARPIRIDHITLP............................................................................. 303
34 -28.000IDP90995 hypothetical protein y1430 [Yersinia pestis KIM 10] y1430 [Yersinia pestis KIM10+]  ali follow..  12  1MRPEVIKVFMFAMAALTTLPAFAQLDGAKKEGKVVVY----SATDIKAAAPLIKGFEAAYPGIKVEYNDMNSTELYNRYISEQASGSTGDVVWSSSDTALKLATDYALEYLSPEQAE----------------WAIWKNKAYGS--TYEPVVFIYNKRLIPQA--DMPDTHIALAKLIVSQPDKFKRKVTTYDIE---------------KSGLGFM-----SVQDFKADPNYFTTLANIAKGGLTVQSSTGTMMERVSSGEIGFNILGSYAETRAKTDPS---LGIAYPKDY-----TLVLSRVTFISQKAPHQNAAKLWVDYLLSEKGQN--ILANQSDIPSIRKDI................................................................................. 321
35 -28.000IDP00471 gene: tbpA; thiamin transporter substrate binding subunit YPO0522 [Yersinia pestis CO92]  ali follow..  12  1.........MFKHIISCLLLISATSALAAEKPTLTVYTYDSFAADWGPGPAIKQAFEAEC-DCQLKFVALEDGVSLLNRLRMEGKNSQADVIL--------------LDNNLVQAAEQTGLFTPSQVDTRNLTLPEPWQNKTFVPYDYGYFAFVYNKEKLK----NPPKSLHELISSKEP----------VIYQDPRTSTPGLGLMLWMQKVYGD----------------QAPQAWQQLAQKTVTVTKGWSEAYGLFLKGEADLVLSYTTSPAYHLIAEKNNNYAAADFSEGHYLQVE-----VAGQLAASKQPELAQRFMQFIVTPAFQNHIPTGN---MYPVIKMDLPAGFETLAVPQTA................................................................... 305
36 -27.400IDP91956 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005733 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  14  1MFKNFKKIAFTSSLI--LLAACSNNASVDKSQEIVIY----TNSASNGRADWLQTKASE-QGYNLRLVDISGGELADRLIAE-KNNAVADMVIGLNEFNRIKAEKLLVKYSP-----------KWADEVDSSLGDSEG---YYSPIVNQPLVLIGNKD------AKMPSDWTDFTDSSYK----------YGISKLSTGTSKNIFASIVSRYK----DEKGELGISD----EGWKVAKAYLKNAHVYAEG-EDYISSIMDNNNDLKYSMMWGSGVLQNQKERYKFQVMSPKVGVPYVTE-----QVGILNTSKKQALLKEFVDWFGSSELQKEWSDKF--GSIPANKKALEQA............................................................................. 314
37 -27.000IDP01491 ABC transporter, periplasmic substrate-binding protein VCA0603 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  1MERMMNKRILKGTLTAIAALMSAHAFAGQ---EVTVY----TAFETDLLAKYKSAFEKENPDIEIKWVRDSTGIMTAKLLAEKDNPRA-EVVWGLASMALLKDQGVLKPYTP-----------KGANELRANLNDPQAQQAW-YGNDAFFNAVCFNEAVAKQLNLPKPQSWEDLTNPVYK----------IAMPNPASSGTGYMQVSAWLQNMGE----------------KAWDYMQRLDQNIAHYTHSGSKPCVQAGMGEVAIGISMATRGAKLKTQGAPLDVIVP-------------IGWESEAVGLVKESDAAKRVVDWSVSKAANELYIES---YPIVGHQDVSKQVPNYPNVEKVMAKMDFTQMGVD-----------------------RARVLQTWSEKFDAKSEPKS............. 339
38 -26.200IDP05164 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_1735 [Bacillus anthracis str. Ames]  ali follow..  18  1MKKSLKSLFVCTLLFSAVVTGCSSKSKTTNEKKIVVY----SAGPKGLAEKIQKDFEKK-TGIKVEMFQGTTGKILARMEAEKKKPVV-DVVVLASAMEGLKKDGQTLAYKEAKQA-----------DKLRSEWSDDKGHYFGY--SASALGIVYNTKNVKTA----PEDWSDITKGEWK----------VNLPDPALSGSALDFVTGYVKKNGK----------------DGWDLFEQLKKNEVTVAGANQEALDPVVTGAKDMVIAGVDYM-TYSAKAKGEPVDIVYPKSG-----TVISPRAAGIMKDSKNVEGAKEFIDYLLSDDVQKQI---SKAYLLPGRTDI................................................................................. 304
39 -25.800IDP01395 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein, putative VC0704 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  5CNEWVSYSQMIKRFLSLMVLNTVCYQASALELNVYLWEDTIAP-------SVVEAWHKKT-GVSVNLFHFDNDDRSLLMLKSVQLP---DIMVLDNVSAFFSRQNVFEDLTALPNRAN---------------MWLQACGTHAVPYFWGSVGIAYRKSLFDK----PPTQWSEVVDIAPAHRGR------VGMLKDSVETLLPALYMLNASPITD----------SIDTLRQAYRLLDAANPHILTYEYVLSYVRSHPQTDNLHMAVSYSGDHYSLNRFFNTQDWDFSVPEGR-----PYLWVDCMAVNSVSPNTVQAKAFLDFLMKPDIAAINAEYIRAASPNYKARALLPVEHREDLSIYLPEQRLAEGI.......................................................... 331
40 -25.300IDP01388 iron(III) ABC transporter, periplasmic iron-compound-binding protein VC0608 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  9TSQKEYSMKKLLSLSAITLSVLAPSAFAAQEVNV-------SYRQPFLIEPMFAEFTKE-TGIKVNVKF-AKEGIAEKLAQE-GEYSPADVILTSERLFELTEKGLTQPLDS-----------KVIEENIPAQYRDSGDEWFAL--TQRTRSVYSSRDRLGKLGD--DFDYMDLAKPEFK----------ICTRSGKHPYNIALVASIIANHGEA----------------EAKAWLEGVKANARKPQGNDRDQVRAIKEGLCDVSLGNSYYLGAMLNDQEQKSWAVYINFPGQNVQGTHVNVSGMAMAKYSPNRENAQKLMEFLTGETAQKMYAEVN--YEYPVKPGVQRSALVESWGEFKA................................................................... 326
41 -24.700IDP92649 iron ABC transporter, iron-binding protein [Streptococcus pneumoniae TIGR4] SP_0243 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  14  1MKKK----WMYYAACSSNESADDSSSDKGDGGSLVVY----SPNSEGLIGATIPAFEEKY-GIKVELIQAGTGELFKKLESE-KEVPVADVIFGGSYTQYTTHGELFENYTS-----------KENDNVIKEYQNTTG---YSTPYTLDGSVLIVNPDLTKG---MNIEGYNDLFKPELK----------IATADPANSSSAFAQLTNMLQAQGGYKDD------------KAWSYVKDLFTLIDG-GLSSSGVYKAVADGEMTVGLSYEDPAVKLLNDGANIKVVYP-------KEGTVFLPASAAIVKKSKNMENAKKFIDFIISQEVQDTLGTTT--TNRPVRKNAKTSENMKPIDKIKTLTEDYDYVI-----------------------KNKSDIVKKYNEVFTDIQSKQ.............. 338
42 -24.300IDP04270 gene: potD; spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Clostridium perfringens ATCC 13124] CPF_2226 [Clostridium perfringens ATCC 13124]  ali follow..  14  3.LKKFLALTCSTLLLSSLFLGCGTQDKNNNVLYVYNWGDYIDP-------ELLTKFKEET-GIDVKYDV--YDTNEIMYQKLNSGNVSYDIVIPSDYMIEKMKEEDMLAKIDYSNIPNYKYIGEQFKNL-------DPTNEYSVPYMWGTVGIIYNTKRVSD----PVDSWNILWNPKYKMPDSVRDAMAVAE----------------KKLGYSLNTE------NLDQIEAAKKELMTQKKDGLILAYMVDQVKDAMVGGEASLAVAWSGDAVTMIERNPDLAYAIP-------KEGSNKWFDAIAIPKNAKHKENAEKFINFLCDPENAEQNVEYIGYSTPNTAAYDLLPEDIRDDKVAYPDEESLKNCE.......................................................... 336
43 -24.000IDP05020 gene: potD; spermidine/putrescine ABC transporter,substrate-binding lipoprotein [Clostridium difficile 630] CD1027 [Peptoclostridium difficile 630]  ali follow..  15  1MIKKAISLIAVGMMIVTLFTGCNKATDSTKVLNVYNVGDYIDE-------SLIDKFEKET-GIDVQYST--YDTNEMMYQKVKSGSTHYDLVFPSDYMVEKMKNEGLLE----LDFKNIPNMKYLDKSFLNPV---DKTNEYSVAYMWGTLGILYNKKEVKD----PMDSWNILWNPKYKMFDSVRDTIGITL----------------KKLGYSMNSV------NPKEINEAKNLLMKQKDL--VLAYVNDEGKDRLLGGEVAMGMLYSGDAVTLMEQNPDLDYAIP-------KEGTNKWVDAMCVPTTAQNKKEAELFINFLLDPENAKVNAEYIGYSTPNTGALKLLDPEITQNPVAYPSKEVLDKCE.......................................................... 328
44 -22.700IDP00421 gene: potF; putrescine transporter subunit: periplasmic-binding component of ABC superfamily YPO1331 [Yersinia pestis CO92]  ali follow..  15  1MFTQRKKWLSGVAAGLLMAAS-VSASAEEKILHIYNWSDYIAP-------DTLANFQKET-GIKVVYDV--FDSNEVLEGKLMAGSTGFDLVVPSASFLERQLSAGVFK----LDKSKLPNEKNLDPELLALVSKHDPDNKYAIPYLWATTGIGYNVEKVKAV--APVNSWDLVLKPENLFLDAPSEIFATVL---------------------NYLGKDPNSTLTADYTGSATDLLLKLRPN--IRYFHSSQYINDLANGDVAVGWAGDIMQASNRAKEAKNGVNVAYSIPKEGALAFF----VFAMPTDAKNQDEAYQFLNYLMRPDVIANISNHVFYANANQAATPLVNAEVRDNPGIYPPADVRAKM........................................................... 344
45 -22.600IDP91991 spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100001132 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  13  1MKKIYSFLAGIAAIILVLWGDSKINSRDSQKLVIYNWGDYIDP-------ELLTQFTEET-GIQVQYET--FDSNEAMYTKIKQGGTTYDIAIPSEYMINKMKDEDLLV----LDYSKIEGIENIGPEFLNQS---DPGNKFSIPYFWGTLGIVYNETMVDE----APEHWDDLWKLEYKLFDGAREVLGLGL----------------NSLGYSLNSK------DPQQLEETVDKLYKLTPN--IKAIVADEMKGYMIQNNVAIGVTFSGEASQMLEKNENLRYVVP-------TEASNLWFDNMVIPKTVKNQDSAYAFINFMLKPENALQNAEYVGYSTPNLPAKELLPEETKEDKAFYPDVETMKHLE.......................................................... 331
46 -22.500IDP05035 gene: potD; spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein [Bacillus anthracis str. Ames] BA_1300 [Bacillus anthracis str. Ames]  ali follow..  17  1MKL--TKRLAGAAISFSLVAGCG---EKKEELNIYSWADNFDE-------QVLRDFEKKY-NVKINYDK--YASNEEMLAKLQAGGAKYDLIQPSDYMVKTMAKMDLLA----LDKKNIPNIENMVSNFKTPA---DPENKYSLVYTWGVTGIAYNKKYVKE----APTSWTDLWNEKYKLLNDSREVLGMGLKKNGFSNSTK----------------------DDAQLKTAATDLQKLLPN--LLAFDTDNIKQKFITEDAWIGTVWSGDAAFIAKDNKDVEYVVP-------KEGGTIWADTLAIPKGAKNKELAEKFMNYLLDEKVSVKNYESIGYSNPNEKAHPLHSKEYRENHMIFLTKEELDRTE.......................................................... 321
47 -21.600IDP05673 hypothetical protein lmo0810 [Listeria monocytogenes EGD-e] lmo0810 [Listeria monocytogenes EGD-e]  ali follow..  15  1MKQ-PVIVVALLMMLLATTMNRSEGYAGSNTLTIYNWGDYIDP-------SLITKFEKET-GIKVIYQT--FDSNEAMMTKIEQGGTTFDIAVPSDYAISKMKEENLLIPLDHSKLPNEKYLDPRFMDL-------DDDNKYSMPYFWGTLGIIYNKEMFPDKNFD---TWNALFDPELKLIDGAREVMGLGL----------------NSLGYSLNDT------NKAHLQAARDKLETMTPN--VKAIVGDEIKLLMADNEAGVAVTFSGEAAEMLSENEDLEYVIP-------KDGSNLWFDNMVIPKTAKNVDGAHKFINFMLKPENAAINAEYVGYATPNAKAVELLPKEISSDERFYPDMDELNNLE.......................................................... 332
48 -21.600IDP01418 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VC1424 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  1MKNKLFASALCAAALFT-----TNAMAKDQELYFYNWSEYIPS-------EVLEDFTKET-GIKVIYST--YESNESMYAKLKTQGAGYDLVVPSTYFVSKMRKEGMLQ----IDHSKLSHFKDLDPNYLNKP---DPGNKFSIPYIWGATGIGINTDMLDKKSLK---NWGDLWDAKWALMDDAREVFHIAL----------------SKLGYSPNTT------NPKEIKAAYRELKKLMPN--VLVFNSDFPANPYLAGEVSLGMLWNGSAYMARQEGAPIQIIWP-------EKGTIFWMDSISIPAGAKNIEAAHKMIDFLLRPENAAKIALEIGYPTPVKTAHDLLPKEFANDPSIYPPQSVIDNG........................................................... 321
49 -21.300IDP01506 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VCA1113 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  1MKT-------FIKGLVLSAVVASSQVYAEQTLNVYAWGGYLPE-------KSLKAFEQQE-GVTINYSTFENNEMYTKLKLLKGTG---DVVFASAYFIEKMGREGLLA----IDHNQIPNMKDAMPTVLGLA---DPQNKFSLPYIWGITGLYYNSSTLPN----GITKWADLWDKQYELIDDIRDVFGMAL----------------KLNGFSINTK------NEEEIKKAYESLVALKKN--VLLYNSDAPHVPYVSGEATLGMQWNGNAYQGQVEMPELKFVMP-------EEGAVLWMDNFTIPSGSKNIPLAHKFINFMYQPENQAEIVQSLGYASATKGGRALLPAELRDNPTIFPSDEDMKKGE.......................................................... 320
50 -20.000IDP01419 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VC1425 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  21LTSMKKLATLLAGSACALSLLSGTAAAEDKELVFMNWGPYINS-------GILEQFTKET-GIKVIYST--YESNETLYAKLKTHNQGYDLVVPSTYFVAKMRDEGMLQ----IDKSKLSNFKNLDSNYLDKP---DPNNDYSIPHVVAITGLAVNTDMYDPNDFQ---SWGDLWKPELKLMDDTREVFHIAL----------------RKLGYSGNST------DDKQIDEAYAELQKLMPN--VLVFNSDNPAAPYLSGEVGLGMLWNGSAAAAQKEGLPIKLVFP-------KEGGIGWVDNFAISSGAKNVDAAHKMIDFLLRPEIAEQISRDTG-----LTGVKASNDKFQDVAPLFPSQEDLDRV........................................................... 342
51 -19.300IDP01383 thiosulfate ABC transporter, periplasmic thiosulfate-binding protein VC0538 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  1MNR------IKSTLTALLLAGSFQASAADQTILN-----SSYDIARELFVAYNPVFAEHWQTVEIKQSHAG----SSAQARSILQGLAADVVTFNQV-VQILHDKGKLIPANWQTLLPN-----------------------ASSPYYSTTAFLVRKG-----NPKNIQDWSDLVRDDVKSVFPNPKTSGNARYT-------------------LAALGFAQKQFGQDNQVQQDEFLKKFLANVAVFDTGGRGATTSFVRGIGDVLI--TFESEVNNIRQQYGADDYQVVVPKTSILAEFPVAVVEKVAKRNGTYDVATEYVSYLYSEPAQRLL---AEFNYRVHDAKVQAE.............................................................................. 293
52 -14.900IDP05439 hypothetical protein lmo2499 [Listeria monocytogenes EGD-e] lmo2499 [Listeria monocytogenes EGD-e]  ali follow..  16  1MKKKYLGIVAMLAAVMLVFAACGSDSSSADKANGS-LTAVGSTALQPLVEAASKEFTNTNPKAQINVQ---------------GGGSGTGLTQVQQGAVEIGNSDVFAEEKDGVDASKLVDHRVAVVGMAPVVNKDVGVKNITKQ---QLIDIFTGK-----------TNWKDVGGKDEKIT-----------------------------------------IINRAEGSGTRATFEKWGPIKAQEQDSSGTVRKIVSETPGAI---SYLAFSYIDASVVGLSLDGVEPTEDKVATNDWKIWSYEHMYTNGEPKGLTKTFLKYMTSDEVQNNIVPQL--GYQSIKSMKVERDASGKLTDVK.................................................................... 302
53 -14.800IDP05442 putative lipoprotein [Bacillus anthracis str. Ames] BA_0171 [Bacillus anthracis str. Ames]  ali follow..  22  1MSKKLLSLFSAVIVAAFVITGCGQSDTTNKEQKENAAKENKTEKTDTTKENKPEEKNPKTRKLKIK............................................................................................................................................................................................................................................................................................................................................................................ 66
54 -13.600IDP05678 hypothetical protein lmo1041 [Listeria monocytogenes EGD-e] lmo1041 [Listeria monocytogenes EGD-e]  ali follow..  19  1MKK---IVLIICCGLLLLLGACEDTPEKVQTTTIHI---SAAASLKDSIDDVKPLFEKANPTIKLSFDFGGSGQIRERV----ESGAPIDGLLASKKDADTLIKQNLAEAGNELVLIEPKNVDQKTEANLEQLLNDASKIAIGDPESVPA----YAKQTLENLNL-----YNAEKA-----------------------------------------------LVLATDVRQVLSYVEA------------GNADAGFVYQTDALLSKKVQVKAKIDEKLHD---------------------YYSAQVSDSDKKEETATFLDFMNKSEAQKILEK.............................................................................................. 249
55 -13.000IDP05504 gene: modA; putative molybdenum ABC transporter,substrate-binding protein [Clostridium difficile 630] CD0869 [Peptoclostridium difficile 630]  ali follow..  15  1MKK-ILGILGLVACLTLGTVGCNSNEKSSDSVELNI---SAAASLKEAMAKIEEEYKKVDSNVKLTVNYGASGSLQQQI----EQGAPCDLISAGQKQMKVLDEEKLLVSDTMKDLVKNSSADSSVSGMKDLTTDKVKKIAVGEAESVPA----YADEVLTNLNL-----KDKLKD-----------------------------------------------LVFAKDVKEVLAWVQS------------GNADVGFVYFSDTVNNDKIKVVEKTDEKTHS---------------------YPVSVIKASKNVDAAKKFEEFLLSESGQKIFEE.............................................................................................. 263
56 -12.700IDP05670 hypothetical protein lmo0617 [Listeria monocytogenes EGD-e] lmo0617 [Listeria monocytogenes EGD-e]  ali follow..  14  1MKKKSILLLMGIITFALALTACGGTEDKASTEK--------IETAKAETKKKSNPNELGDYKVEILSSEVVKDFEGNNIKTKFTNNSKENISFMVAIDQQAFQNGTQLETTVSADASMGGSEKDVQPG-----GTLEVTELYKLQDTQNTVDIEATELISFSK........................................................................................................................................................................................................................................................................... 154
57 -12.500IDP91988 phosphate-binding protein PstS 1 (PBP 1) [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007640 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  11  1MKKKKLALSLIAFWLTACLVGCASWIDRGESITAV-----GSTALQPLVEVAADEFGTIHVGKTVNVQ---------------GGGSGTGLSQVQSGAVDIGNSDVFAEEKDG----------------------IDASALVDHKVAVAGLALIVNKE-VDNLTTEQ-TNWKEVGGKDLPIS------------------------VINRAAGSGSRATFDTVIMEGQSAMQSQE------------QDSNGAVKSIVSKSPGAI---SYLSLTYIDDSVKSMKLNGYDLSPENISSNNWPLWSYEHMYTLGQPNELAAEFLNFVLSDETQEGIVKGL--KYIPIKEMKVEKD............................................................................. 280
58 -12.100IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames]  ali follow..  31  1MLKK-LGILVLGSAVALSLVACGDSTKEASNEK............................................................................................................................................................................................................................................................................................................................................................................................................. 32
59 -11.800IDP02672 hypothetical protein FTT1602 [Francisella tularensis subsp. tularensis SCHU S4] FTT1602 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  18  1MKK--QLFAISITTALLVLSACGQTVKQNQQNNSTSTSDNQSDTSTKVDNDPTAPVRNNNPTTSELFEGENNFNYNNNIQNSQNAGGTPTL................................................................................................................................................................................................................................................................................................................................................... 114
60 -11.700IDP05119 ABC transporter, substrate-binding protein [Clostridium difficile 630] CD2989 [Peptoclostridium difficile 630]  ali follow..  14  1MKKKLLIGITILTLATASLAGCAKKNNGEKLSEINLTYVKSPLNVPSIIQKQDDLFGKEKDNIKVNFHEITTG---PEQTQALAAGEI-DFLHALGGTSALIAASNGVELKILNTYSRSPKGFMILTNNNSIKSAADVGKKVAGPKGTILHQVLIS--ALDKEGLSM----DDVEFV----MGIPEASAALSDGSVDAALIAGPAALKAMKSGSKLVANSTDFAEKHPEIVERF.................................................................................................................................................................................................... 238
61 -11.400IDP91970 lipoprotein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005433 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  18  1MKKKWLGLVALATVAGLALAACGNSEKADNATTIKIATVNRSGSEEKRWDKIQELVKKDGITLEF----TEFTDYSQP-NKATADGEVDLNAFQHYNFLNNWNKENGKDLVAI-------------------------ADTYISPIRLYSGLNGSANKY---------TKVEDIPANGEIAVPNDATNESRAL-------------YLLQSAGLIKLDVSGTALATVANIKENPKNLKITELDASQTARSLSSVDAAVVNNTFVTEAKLDYKKALFKEQADENSKQWYNIIVAKKDW------------ETSPKADAIKKVIAAYHTDDVKKVIEESSDGLDQPV..................................................................................... 283
62 -11.000IDP05554 hypothetical protein CD3669 [Clostridium difficile 630] CD3669 [Peptoclostridium difficile 630]  ali follow..  12  1MKNKKIMLVLSILSISIFAVGCTNAQNGSDSSKKE--NKAKPTPKEETKAQSATIYDVDKTDLIENKVDLNKIDENTLFEELQKLKVVPESAKLNSFTTKDIDGVKTGILD--------------VSSDFTKSNLGSDAETLMLDSVARTYIKNMNVEQIKESGLEEGDYLK.................................................................................................................................................................................................................................................................. 191
63 -11.000IDP05370 putative ABC transporter, substrate-binding protein [Bacillus anthracis str. Ames] BA_5220 [Bacillus anthracis str. Ames]  ali follow..  16  1MKK--LLLTALISTSIFGLAACGGKDNDEKKLVVGA----SNVPHAEILEKAKPLLEKKGIELEV----KKFQDYVLP-NKSLADKDLDANYFQHIPYLEKEIKDKKYEFEVAGKIH--LEPIGVYSQKYKSLKELPDGATIIMSNSVADHG------ILQKEGI------------------------------------------LKIKDGVDPVKATPKDIADNPKNLKFKTD----EPGLLPQVYNNKEGDAVLINSNYAIDTKLNPEKDAIAIESNDSPYANV-----------------VAVRKGDKDKKEIKELVEVLHSKEIEDFINKEYKGAVVPVKE................................................................................... 270
64 -11.000IDP91442 ABC-type phosphate transport system, periplasmic component [Vibrio vulnificus CMCP6] VV1_0466 [Vibrio vulnificus CMCP6]  ali follow..  10  1MKRWWLSLLLMGGISASAQALDTPLQPYKKIPGVS-LLSVGSDTLAGMTTLWVEEFKALYPNINAQVQASGSSTAPPALTEQTA-----QFGPMS---------------------------RPMRLREVEAFERTHGYKPTALRVAIDAIGIFVHQD-VQGLNFPQ-STWAQL-GIDAEWAKRNFQLFGRNSVSGTGYFKKHALCGGDFKSQVNEQPGSASVVQSVASTLSGIGYSGVGYRVAGVRLLPIAKQGNEFVYPSRENILTGDYPLSR----------------------------VYVNKHPSKALSPIEAEFIKFIYSAQGQA---LVEKDGYVSITEEFAKQE............................................................................. 311
65 -10.900IDP05272 hypothetical protein lmo1649 [Listeria monocytogenes EGD-e] lmo1649 [Listeria monocytogenes EGD-e]  ali follow..  19  1MKK--WLLVVLTLALGLSLAACSGSNSSDKKEDTKKETTSDKDKVLNYYMDLVDVVNENNGDYNAYVGAVGADPKPSEADLAALAKPASESALKVSEALASEKTPDLGKSTDDFKAAVKQLSDAYKLEADALKASGRDTTKADEAMAKADEAI---ASVLKDAGLNPSSITTDTAS.............................................................................................................................................................................................................................................................. 171
66 -10.900IDP05685 gene: opuCC; hypothetical protein lmo1426 [Listeria monocytogenes EGD-e] lmo1426 [Listeria monocytogenes EGD-e]  ali follow..  11  1MKKKFALFSVLLLTSSLFLSSCSPGLGGSSKDTIRI--GAMATTESQIVSNILKELIEHDTGLKVEIVNNLGST--IVQHQAMLNGDV-DI---------TATRYTGTDLVGPLGEEAIKDPEKALAAVKKGFEERFHQTWFDSYGFANTYVFMVRQDTAKKYNLN---TVSDMRKVENELT---SKAYDIEFKKIFPMQIGLIYTALGYSTDGRIPTKDDKKFFKHPELKTTIN-MQKLNYEADGKLKEPSIVAQEFLQKN........................................................................................................................................................................ 301
67 -10.700IDP04512 gene: modA; molybdate ABC transporter, molybdate-binding protein [Clostridium perfringens ATCC 13124] CPF_2342 [Clostridium perfringens ATCC 13124]  ali follow..  18  1MRKKISLPIIMAIGMLSLLFVGCTNNKEEKTLTV-----SIAASLQKPMEKIASNFEKEN-GVKIQYNVGGSGTLKKQI----SDGADVDLFSANTKYAKELIDEGLVNKDESYKILNNIENNDYNKPINSLEDLKNVEGKIAIGEISTVPAGQYAKESLEKVGA-----YKDIED-----------------------------------------------LVFARSVTNVKTYVEN------------GEANLGFVYKTDALDLKNSKIVYEVPNDYHK---------------------YELCLLKNSKNNKEAKKLIEYLKGEESKKIFSE.............................................................................................. 250
68 -10.500IDP05547 putative lipoprotein [Listeria monocytogenes EGD-e] lmo0285 [Listeria monocytogenes EGD-e]  ali follow..  19  1MKKTKGLGILLASSLVLGLAACGGGSDDKALSTEKITIGTTAGPHQQIAEEVQKLAKKDGLEIKI----KTFDDYNTP-NTALNDGDLDANNYQTIPFLEQQKKDKGYKLDVAFKTV--AFPMGIYSNDIKDLKNLKKGDKIAVPNDPSNEY------LFEDAGVEEKATKKDIAENPLDLE----------------------------------------VELEASQIPAQLD-----------------EVAAAAINTNFAMGAGLSINKDAIYHEPTKDNPYPNV----------------FVVRSANKDDEVVKTLEKYYHSDEVKAFIEKEFNGSVVPA..................................................................................... 272
69 -10.400IDP05267 hypothetical protein lmo0255 [Listeria monocytogenes EGD-e] lmo0255 [Listeria monocytogenes EGD-e]  ali follow..  14  1MKK--FLSILSILVLALLVTACGSDSSDKKSAKKE--------------KMETVTYIADINGAKLEATFSHVGDNLRKVDQKMV-----PLTALGLESGANLDDATKKQLEEQVASQYSAYKE--SKGASLETKFTDEALELTMSVDLYKADK---DSVASLLGGTTDPKNVSLKETVKQFEAQG..................................................................................................................................................................................................................................................... 161
70 -10.300IDP04390 gene: pstS; phosphate ABC transporter, phosphate-binding protein [Clostridium perfringens ATCC 13124] CPF_0618 [Clostridium perfringens ATCC 13124]  ali follow..  12  1MNRRRVVIALSSILAMGFLLTGCGGGSRANIIKIS-----GSSSVGPLVEAEAEVFKKEMPDITVEVNQLGSSAGIKDAINGTV-----EIGISSRDLKEKELESGIKEKPIAYDGMSVIINNENPVQNLTMEQIRD----------------IYTGKI---------TNWKEVGGEDTPIV---------LVSREDGSGTRDAFQEIVGFNSEE-ISPQAQISDGSGSIKTMVA----------GNKNAIGYISFSYVDDSVHAV-------------------GVKPTAENVQNKKYKLSRPFLLVYKEENLNENSKKFIDFIMSKEGQE---IVEEDGLISVT.................................................................................... 272
71 -10.200IDP00164 gene: acfC; accessory colonization factor AcfC VC0841 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  1MYFMKSKNRFLLISLLSF--------STSVFADVNLY---GPGGPHVPLIKVAESFEKSQ-SKRVNITFGPQATWNDKAKKNA------DILFGASEHSALAIAEGHSERFSKFNIH---------------------------PVFMREAIILVKKG--NPKNI---KGMADLLKPGIGIVVNDGAGVS---------------------------TSGTAVWEDSVGRMKNVEKLQAFRSNIHVFAPNSGSARKAFVDGEDI----DAWITWVDWAIANPTIGDMVRMEDEYRIYRD------FNVVLAKNPSSEAIDFFDYLTKSKDAEAIFQH............................................................................................. 251
72 -10.000IDP05207 putative sulfonate ABC transporter,solute-binding lipoprotein [Clostridium difficile 630] CD2365 [Peptoclostridium difficile 630]  ali follow..  12  3LSKKIQALILFGVMGTSILTGCSSKPKEKDDYTITVGYYNCDHMTAGPVAESAGIYKDL--GLNVKTVGNG------KVPEAMAAGKM-DAGYIGTKGLVGAIPKGS--------------------------------TIAANNHTGGSEYLIVSKDIKEPKDLI-----------------------GKKIATDMSDFLWTSDYGPETGLP-------------DPSKYEVVNM------------DSDKDKYLALKTGKIQAFTSCDPWGSVAENDGAGKIIASTQYKEKANGKEYNCCSFSLNKNFIKEHPDLAKKLVLAHTKAIEYIYTNPAEAAKIFAKYYNVEEEVALRTGEEYKNNLQMYKDLKALDDIPKYEDTIDTSLLDSCGADDFDKFIKEKVNPEFPEGMSYEDWKAKV........ 362
73 -10.000IDP01405 gene: metQ; lipoprotein YaeC VC0905 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  1MKFLKSLLTIAAAASTLILAGCGEKAVDNNKVKIGV----MAGAEAQVAEVAAKVAKEKY-NLDVELVTFT----YVTPNAALDDGSIDANAFQHKPYLDKQIADRGYKLAIVGNTF--VYPIAGYSKQIKSVDELQDGARIAVPNDPTNLG------LLQQQGLGLLATVRDIVENPKKLE----------------------------------------LELDAAQLPRSLD-----------------DVALSIINTTYASSINLTPEKDGIFVENKESPYVNI-----------------LVAREANVNAENVQNFKKAYQTDEVAKAASEIFQGGAVKG..................................................................................... 268
74 -10.000IDP04389 gene: pstS; phosphate ABC transporter, phosphate-binding protein [Clostridium perfringens ATCC 13124] CPF_0617 [Clostridium perfringens ATCC 13124]  ali follow..  13  2FKKRLIAIIGTIFIGATAMVGCNSGGSEAKSTNS---SISGSTSVGPVMEAEAEAFKTKKPDVSIEINQIGSSAGIKNAMEGVS-----EIGMASRDLKGEEKQAGLKEVEIAYDGIALITHKNNPVKDLTLVQIKD----------------IYTGKI---------TNWKELGGNDAPIV---------VVSREDGSGTRDAFQEIVGFKAEE-LTVNSQISDGSGNIKSLVQ----------GNENAIGYISFSYVDDSVSAV-------------------GVEATPENVLNKSYKVSRPFLAVYKEENLTESGKSFIDFILSEEGQD---IVAKEHLIKVK.................................................................................... 276
75 -9.870IDP05429 hypothetical protein lmo0791 [Listeria monocytogenes EGD-e] lmo0791 [Listeria monocytogenes EGD-e]  ali follow..  25  1MKKG-LFSMVLVLAMVLVLSACGASRVEPKKAGEITVNAVVYNKDTDKVKDVYGEDGSK................................................................................................................................................................................................................................................................................................................................................................................... 58

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.