current user: public

If you have questions about the server, please let us know.

Query: IDP05730 putative acetyltransferase [Clostridium difficile 630] CD0675 [Peptoclostridium difficile 630], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MIEGIKFIKAEEKYIYSYWQTFDKIAKERKYLAMDEAFPFEETVEFIKNIINKNLPQLFIIDLESDNCIGWCDVLPKTEKVGYLGMGILKEYREKGIGSSLLKQIIDLSKEYGYEKIELDVFKSNSRAIHVYKSLGFVEVNTISSGFTWNDRPVKEEVIQMELTLILast
1 -79.400IDP05730 putative acetyltransferase [Clostridium difficile 630] CD0675 [Peptoclostridium difficile 630]  ali  100  1MIEGIKFIKAEEKYIYSYWQTFDKIAKERKYLAMDEAFPFEETVEFIKNIINKNLPQLFIIDLESDNCIGWCDVLPKTEKVGYLGMGILKEYREKGIGSSLLKQIIDLSKEYGYEKIELDVFKSNSRAIHVYKSLGFVEVNTISSGFTWNDRPVKEEVIQMELTLI 166
2 -57.300IDP91766 gene: yhhY; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3441 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  18  1.MSEIVIRHAETRDYEAIRQIHAQPEVYCNTLQVPHP-----SDHMWQERLADRPGIKQLVACIDGDVVGHLTIRPRRSHVADFGICVDSRWKNRGVASALMREMIEMCDNWRVDRIELTVFVDNAPAIKVYKKYGFEIEGTGKKYALRNGEYVDAYYMAR..... 160
3 -53.500IDP92642 gene: rimI; ribosomal-protein-S18-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4373 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  17  2....NTISSLETTDLPAAYHIEQR------------AHAFPWSEKTFASNQGER--YLNFQLTQNGKMAAFAITQVVLDEATLFNIAVDPDYQRQGLGRALLEHLIDELEKRGVATLWLEVRASNAAAIALYESLGFNEATIRRNYYPTTDGREDAIIMALPISM. 148
4 -52.600IDP00047 streptothricin acetyltransferase, putative BA_3185 [Bacillus anthracis str. Ames]  ali follow..  19  2...SLLIRELETNDLDNFPEIDDSFIVNARLMLEKSYLQNDNEELVYNEYINKP-NQIIYIALLHNQIIGFIVLKKNWNNYAYIDITVDKKYRTLGVGKRLIAQAKQWAKEGNMPGIMLETQNNNVAACKFYEKCGFVIGGFDFLVYKGLNMTSDEVAIYWYLHF. 182
5 -49.000IDP95033 ; aminoglycoside acetyltransferase [Pseudomonas aeruginosa] CAD53575 [Pseudomonas aeruginosa]  ali follow..  12  2ISTQTKITRLNSQDVGVMRAMLGMF---GEAFEDAENYCRAQPSDSYLQDLLCGSGFIAIAALQGQEVIGGLAAYQQRKEIYIYDLGVQGAYRRRGIATALINELQRIAHDIGAYVIFVQADYGDDPAVALYTKLGIREDVMHFDIEPQPAA.............. 156
6 -48.900IDP95442 set236a-044 [Undefined organism]  ali follow..  18  1....VEYKLLEKEDLELMKEIIED-------------DDIEFDLEKINEFYNDK-NVIGFIAKAENKIVGFAYGYDIIHAYFIYSIGMLPDYQDKGYGTKLLGFIKDYISSNGFFEMFVLTDKGNPRACHVYEKLGGKNDFEDEICYVYDFEGDEK.......... 143
7 -48.900IDP95410 set236a-012 [Undefined organism]  ali follow..  10  2....LIYRRLTEADAEAMRQMNQMF---GAAFKDTKTYRYDQGDDAYFQRILGKDHVIVLACFHAGQVVGGLVAYMARSEIYIYDLAVDESHRRQGIATELINELKAIAAKTGAWVIFVQADREDEPAIQLYEKLGVREEPLHFDINLEEGN.............. 152
8 -47.600IDP92718 gene: aacC1; aminoglycoside-(3)-N-acetyltransferase [Serratia marcescens] AAB20441 [Serratia marcescens]  ali follow..  10  24.MGIIRTCRLGPDQVKSMRAALDLF---GREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLRSEIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIREEVMHFDID................... 172
9 -46.900IDP92645 gene: ypeA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b2434 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  1....MEIRVFRQEDFEEVITLWERCDLLRPW----------NDPEMDIERKMNHDVSLFLVAEVNGDVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQINVPEDNDMVLGMYERLGYEHADVLGKRLIEDEEY............. 141
10 -46.600IDP95409 set236a-011 [Undefined organism]  ali follow..  14  1MLKALHSSRQYNTPLE-------IVESRNKNLLVPILHDADEDDVRIASAIVDM-ANISYAAYIGDECVGAAMMHWQLDESEILYIAIRAADRGKGYGRELIAAIVNMARERSTQALVVGTASTSVDNILFYQKCGFRMDSVRKDFFNYEHGIQLRDMVMLRYEL. 166
11 -46.500IDP00087 gene: STM2449; putative acetyltransferase NTL01ST2379 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  34ATNTMEIRVFRQEDFEEVITLWERCDLLRPW----------NDPEMDIERKVNHDVSLFLVAEVSGEVVGTVMGGYDGHRGSAYYLGVHPEFRGRGIANALLNRLEKKLIARGCPKIQIMVRDDNDVVLGMYERLGYEHSDALGKRLIEDEEY............. 178
12 -46.400IDP02174 putative acetyltransferase [Yersinia pestis CO92] YPO3031 [Yersinia pestis CO92]  ali follow..  14  1....MEIRIFQQDDFEEVILLWEHCDLLRPW---------NDPEMDIERKLNHD-PELFLVAEVNGTIVGSVMGGYDGHRGSAYYLGVHPDYRGRGFANALISRLEKKLIARGCPKLNIMVREDNDAVIGMYEKLDYETQDTLGKRLIVDQEY............. 141
13 -46.300IDP92031 N-terminal acetyltransferase complex subunit ARD1, putative [Toxoplasma gondii ME49] TGME49_019760 [Toxoplasma gondii ME49]  ali follow..  12  2....ATLRRADVFDLFAMQNANFI------------NLPENYIMKYYFFHAVSWPQLLSVSHDSQGKLVGYVLAKLEEDHGHVTSVAVLRQSRKLGLASKLMNMTQHMEEVFDADYASLHVRVTNRAAYSLYKHLGYRIHDIDKEYYADK-----EDAFSMRNYF. 152
14 -43.900IDP01616 spermidine n1-acetyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] VC_A0947 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  20  1MNSQLTLRALERGDLRFIHNLNNN-RNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQS.. 166
15 -43.800IDP91869 gene: aac(6`)-Ih; aac(6`)-Ih [Acinetobacter baumannii] AAC41391 [Acinetobacter baumannii]  ali follow..  14  1....MNIMPISESQLSDWLALRCLLWPDHE----------DVHLQEMRQLITQAHRLQLLAYTDTQQAIAMLEASIRYEYVNLEGIFVLPEYRRSGIATGLVQQVEIWAKQFACTEFASDAALDNQISHAMHQALGFHETERVVYFKK.................. 143
16 -43.600IDP95405 set236a-007 [Undefined organism]  ali follow..  12  2...TYRIQQVTPADLDLMNELLSVF---GQAFDDEETYNGKRPGAGYMRRLLESDNFIALAALNDQKVVGGLAAYELRSEIYIYDLAVAKNHRRKGIATALIMELKKIAAARGAYVIFVDTGAEDEPAIELYTKLGIREDVLHFDIPVENGD.............. 155
17 -43.300IDP95439 set236a-041 [Undefined organism]  ali follow..  14  1LGGDFVVREATQADALALAELAIKLWSSHTISELQSEF----------LDLICSDNAVCFIKYVGSKAVGFAQCQLRND-GYLEGIFVEEEYRHNGYAKELLSKCEKWAKEKHCTEFASDCEINNEISLQFHLSMGFEEANR........................ 141
18 -43.000IDP95418 set236a-020 [Undefined organism]  ali follow..  13  7IDNFLKIERLAENDLPKFIQLIRLFEA-----VFEMKNFSIPDSEHLQKLLNQN-NFYVFVALLENKIVGGLTSYVLEQLAYIYDLAVDTNWQRQGIGKKLITATNQFYTEKGFEEVFVQADKVDDYALDFYRSTKPTAE.......................... 146
19 -42.700IDP95032 ; aminoglycoside acetyltransferase [Salmonella enterica subsp. enterica serovar Newport] AAR21614 [Salmonella enterica subsp. enterica serovar Newport]  ali follow..  11  2...SVEIIHLTGNDVALLQSINAMF---GEAFNDQDSYARNKPSSSYLQKLLSTSSFIALAAVDEQKVIGAIAAYELQKEIYIYDLAVAATRRREGIATALIKKLKAIGAARGAYVIYVQKGVEDQPAIELYKKLGTIEDVFHFDIAVEQSK.............. 155
20 -42.600IDP95031 ; aminoglycoside 3`-N-acetyltransferase [Pseudomonas aeruginosa] AAA88422 [Pseudomonas aeruginosa]  ali follow..  12  23.MSIIATVKIGPDEISAMRAVLDLF---GKEFEDIPTYSDRQPTNEYLANLLHSETFIALAAFDRGTAIGGLKFEQARSEIYIYDLAVASSHRRLGVATALISHLKRVAVELGAYVIYVQADYGDDPAVALYTKLGVRED.......................... 164
21 -42.500IDP95445 set236a-047 [Undefined organism]  ali follow..  24  10...................................IDDNMVFDIDNLKGFLNDT-SSFGFIAKENNKIIGFAYCYTLLRMFYLHSIGMLPNYQDKGYGSKLLSFIKEYSKEIGCSEMFLITDKGNPRACHVYEKLGGKNDYKDEIVYVYDYEKGDK.......... 134
22 -42.400IDP92643 gene: rffC; TDP-fucosamine acetyltransferase [Escherichia coli K12] b3790 [Escherichia coli K-12]  ali follow..  13  37.ASDSGAVVAQETDIPALRQLASAAFAQSRF--YAPDASSRFYAQWIENAVRGTDHQCLILRAASGDIRGYVSLRELNAT-----DARIGLLAGRGAGAELMQTALNWAYARGKTTLRVATQMGNTAALKRYIQSGANVESTAYWLYR.................. 181
23 -42.400IDP91868 gene: aac(6`)-Ig; aminoglycoside 6`-N-acetyltransferase [Acinetobacter haemolyticus] AAA21889 [Acinetobacter haemolyticus]  ali follow..  15  1....MNIKPASEASLKDWLELRNKLWSDS-----------EASHLQEMHQLLAEKYALQLLAYSDHQAIAMLEASIRFEYVNLEGIYVLPAHRRSGVATMLIRQAEVWAKQFSCTEFASDAALDNVISHAMHRSLGFQETEKVVYFSK.................. 142
24 -42.300IDP95403 set236a-005 [Undefined organism]  ali follow..  12  2...SLDVHQLSPNEVALMETLLATF---GEAFNDMETYTGNRPRGAYSRRLLESDYFIALAALEYGEIVGGLAAYELKKEIYIYDLAVAKAHRRRGIATALIEKLKELGAARGAYVIFVQTAIEDEPAIALYSKLGVREEVLHFDIPVSQNN.............. 155
25 -41.500IDP01688 GNAT family acetyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1313 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  17  1MIKLKNFAELNSQEIKLIFKWRNH--PDISQFMKTKHIDFEEHLRFIRN-LHQDSNKKYFLVFQDEQIIGVIDFVNITTKSCEFGLYAIP--DLKGVGQVLMNEIKKYAEILKVDTLKAYVFKDNHKALKLYQQNHFTIYDEDKDFYYVCLKQSHCKALP...... 156
26 -41.000IDP01351 toxin resistance protein VCA0387 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  1....MEIXTGEFEDIAGITDIFNFYIEQTNARFEEFPFTLENREEWFSQFSRTAKYQ-IYVAVENGVLQGFACSIPAFDDTVEVSVYLAQEAKGKGLGSKLYTQLFSSIRAYGVHRILSGVALPNDASVALHKRFGFREVGISNEYAKKHGQYISSLWLEKALN.. 164
27 -40.800IDP91767 gene: speG; spermidine N1-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1584 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  19  5..HSVKLRPLEREDLRYVHQLDNN-ASVMRYWFEEPYEAFVELSDLYDKHIHDQSERRFVV-ECDGEKAGLVELVNHVHRRAEFQIIISPEYQGKGLATRAAKLAMDYGTVLNLYKLYLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQYRNAIRMCIFQH.. 167
28 -40.600IDP92629 gene: yncA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b1448 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  15  1....MSIRFARKADCAAIAEIYNHAVLYTAAIWNDQTVDADNRIAWFEARTLAGYP--VLVSEENGVVTGYASFGDWRSFDGFHSVYVHPDHQGKGLGRKLLSRLIDEARDCGKHVMVAGIESQNQASLHLHQSLGFVVTAQMPQVGTKFGRWLDLTFMQLQLD.. 163
29 -40.600IDP92640 gene: phnO; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b4093 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  11  1.MPACELRPATQYDTDAVYALICELKQAE---------FDHHAFRVGFNANLRDPNMRYHLALLDGEVVGMIGLHLQFH-GEIQELVVMPQARGLNVGSKLLAWAEEEARQAGAEMTELSTNVKRHDAHRFYLREGYEQSH......................... 137
30 -40.500IDP95485 spermidine acetyltransferase [Staphylococcus aureus] ADV68932 [Staphylococcus aureus]  ali follow..  13  1....MKLRALEYSDLLFVHELNNE--YSIMSYWFEEPYESLTELQYLFDKHLLDESERRFIVEDENQVVGIVELVEYIHRNCEIQIIIKPEFSGKGYAKFAFEKAINYADILNMHKIYLYVDTDNKKAVHIYESQGFKTEGLLKEQFYTKGKYKDAYFMSLLKS.. 161
31 -40.500IDP95484 gene: speG; spermidine acetyltransferase [Yersinia pestis Z176003] ADE65402 [Yersinia pestis Z176003]  ali follow..  18  4.TSSVRLRPLEREDLPFVHQLDNN-ASIMRYWFEEPYEAFVELCDLYDKHIHDQSERRFII-ESQGTKIGLVELVEHIHRRAEFQIIIDPTHQGKGYAGAAAKLAMEYGSVLNLYKLYLIVDKENEKAIHIYSKLGFEIEGELKQEFFINGEYRTVIRMCIFQP.. 167
32 -40.400IDP95253 acetyltransferase [Acinetobacter baumannii ATCC 17978] YP_001084790 [Acinetobacter baumannii ATCC 17978]  ali follow..  16  1....................MLEDSVNNGASIGFLAPIEKNEVLNYWREVNHKQGNSRLWIAIQEGTVVGSVQLSLVSKKAEVEKLMVLTSARKQGIATLLLNELENFSKEKGLRLLVLDTREGD-VSELLYSKIGFVRVGVIPNFALSSNGNY-DGTAIYYKKLV 151
33 -40.300IDP00086 gene: yncA; putative acyltransferase NT01ST1973 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  1....MTIRFADKADCAAITEIYNHAVLHTAAIWNDRTVDTDNRLAWYEARQLLGYP--VLVSEENGVVTGYASFGDWRSFDGFHSVYVHPAHQGKGLGRKLLSRLIDEARRCGKHVMVAGIESQNAASIRLHHSLGFTVTAQMPQVGVKFGRWLDLTFMQLQLD.. 163
34 -40.100IDP95438 set236a-040 [Undefined organism]  ali follow..  19  1.....MLKIAEKEDVPVAAELAGMLWPHH---------SREELEGELLSFIESG--GMVFLWMEEGNPVAFAQCGIRTDYVELEGIFVLEKFRRRGIGKVLLTACEEWAKEQGCEEFASDTELDNAEGLSFHSGAGFYEANRIVCFVK.................. 141
35 -39.800IDP95034 aminoglycoside acetyltransferase [Corynebacterium striatum]  ali follow..  14  1MTTTNEIRVAEVADAGVVAKLLRDFNTE------FDTPVPEGLEERFAQIIAHDDAFVLLA-----GDIGFAYVTLRPS-AMLDELYVAPAHRNRGVGTALLQRVFEEIRKHSAGELQINVDEVDTDARRFYERHGLTNIE......................... 136
36 -39.300IDP95450 set236a-052 [Undefined organism]  ali follow..  16  5..KRVSFRPMSEDDLVLMLKWLTDDRVLEFYDGRDKKHTQKTIREHYTEQWADE--IYRVIIEYDTIPIGYAQIYRIQEKIYAMDQFIEPEYWNMGIGAEYCRVVCQYLTEMDANAVILDPRKNNPRAVRAYQKAGFEIIKELPEHELHEGKKEDCVLMEW..... 176
37 -39.100IDP95446 set236a-048 [Undefined organism]  ali follow..  16  5..KRVSFRPMSEDDLVLMLKWLTDDRVLEFYDGRDKKHTQKTIREHYTEQWADE--IYRVIIEYDTIPIGYAQIYRIQEKIYAMDQFIEPEYWNMGIGAEYCRVVCQYLTEMDANAVILDPRKNNPRAVRAYQKAGFEIIKELPEHELHEGKKEDCVLMEW..... 176
38 -38.700IDP00230 putative acetyltransferase YPO3444 [Yersinia pestis CO92]  ali follow..  14  6.PIRLLVRPITAGDNLAIANVIREVSAEFGLTADKGYTVSDPNLDHLYELYSQPRSA-YWVIEVDGHIAGGGGVAPLLGGCELQKMYFLPILRGKGLAKQLALQALAFARQQGFGRCYLETTASLTSAVGLYERLGFEHIG......................... 148
39 -37.700IDP92644 gene: yjgM; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4256 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  6.PQSPVMRRLTLQDNPAIARVIRQVSAEYGLTADKGYTVADPNLDELYQVYSQPGHA-YWVVEYEGEVVGGGGIAPLTGSCELQKMYFLPAIRGKGLAKKLALMAMEQAREMGFKRCYLETTAFLKEAIALYEHLGFEHID......................... 148
40 -37.600IDP91382 histone acetyltransferase HPA2 [Vibrio vulnificus CMCP6] VV1_1470 [Vibrio vulnificus CMCP6]  ali follow..  15  1MSEDFVLRPITVEDNASIANVIRQVSAEYGLTADKGYSVADPTLDDLFSIYSQANAA-YWVVEHQGKIVGGGGFSALAGVEGVCELQFLPICRGQGLAKKIVSLSRSAAKKMGYQRCYLETTACLKEAIALYEKLGFEHL.......................... 144
41 -37.600IDP95422 set236a-024 [Undefined organism]  ali follow..  18  50KGTNIEIVNFSSELRTHFERLNRGWIERQFEMEPLDYLLLQNPETEII----EKGGAVLFAVASRGEVVGTAALKNEGEGVYELSMAVDEESRGLGIGKALGLAALDRVRKMGAVKVILYTNSALEPAINLYRKLGFIDVPVTEKGYTRAD-------VKMEIEF. 204
42 -36.800IDP02595 acetyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT1384c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  16  1....MKIREATAKDFDDVVYIWSEHLLNNCQFFTTNEI--NNQGKLVVEKYLNNPAFKSFVLTVEDQVIGFSCI----KDNEILFSTVEQRFLGKGFRSFMLKYLLE-----NYAVDTTYVYSANIQTLAFYTSIGFIIEDKIDD..................... 130
43 -35.300IDP01725 acetyltransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA2534 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  14  5.AERLLIRKFEFKDWEAVHEYTSD--SDVMKYIPEGVFTEEDTRNFVNKNMGENAKNFPVILIGENILVGHIVFHKFGEHTYEIGWVFNPKYFNKGYASEAAQATLKYGKEMKLHRIIATCQPENTPSYRVMEKIGMRREGYFKKCIPHGNEWWDEYYYAILEE.. 167
44 -34.800IDP92632 gene: rimJ; ribosomal-protein-S5-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1066 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  11  15.TDRLVVRLVHDRDAWRLADYYRHFLKPWEPVRDESHCYPSGWQARLGMINEFHKQYFGLFDPDEKEIIGVANFSNVVRHACYLGYSIGQKWQGKGLMFEALTAAIRYMRTQHIHRIMANYMPHNKRSGDLLARLGFEKEGYAKDYLLIDGQWRDHVLTALTTP.. 188
45 -34.600IDP92646 gene: yjaB; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4012 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  2...VISIRRSRHEEGEELVAIWCRSVDATHDFL--SAEYRTELEDLVRSFLPEA--PLWVAVNERDQPVGFMLL----SGQHMDALFIDPDVRGCGVGRVLVEHALS-----MAPELTTNVNEQNEQAVGFYKKVGFKVTGRSEV..................... 130
46 -34.300IDP05291 putative acetyltransferase [Clostridium difficile 630] CD1211 [Peptoclostridium difficile 630]  ali follow..  21  5MAQNITLQFVEEKDLENLENVKLLFTEYSNSLNIDLCFQDFNNELKTLPGKYKKPSGSLILAFVDENLAGCVALKKLEGKICELRLYVRNQFRGLKIGKILLEEIIEEAKKFGYTHMRLDTLPSMKSAQGLYEKFGFYDIE......................... 146
47 -33.900IDP95293 gene: aac(6`)-Ib; aminoglycoside 6`-N-acetyltransferase type Ib [Klebsiella pneumoniae] AAL93141 [Klebsiella pneumoniae]  ali follow..  17  23..DSVTLRLMTEHDLAMLYEWLNRSHIVEWWGGEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGGVRGIDQLASQLGKGLGTKLVRALVELLNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTVT...................... 178
48 -33.100IDP91269 acetyltransferase, GNAT family [Bacillus anthracis str. Sterne] NT05BA2958 [Bacillus anthracis str. Sterne]  ali follow..  16  8.TERLQLRELTLLDAETMFHYFSK-ESVIRYFGMDSFENIEQAKTTIQTFKNRYEEGWGIEKKGTGQLIGTCGFINHHHKRAEIGYELDDTYWGQGYASEALQAILTYGETLQLIRIAAVVYVENKASQKLLSKAGFQEEGLLRKHMIQNGVAHDTILYSLLKE.. 176
49 -32.800IDP92628 gene: rimL; ribosomal-protein-L7/L12-serine acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1427 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  13  7VSESLELHAVAENHVKPLYQLICKNKTWLQQSLPQFVQSEEDTRKTVQGNVMQRGYAKMFMIFKEDELIGVISFNRPLNKTAEIGYWLDESHQGQGIISQALQALIHHYQSGELRRFVIKCRVDNPQSNQVALRNGFILEGCLKQAEFLNDAYDDVNLYARIID.. 177
50 -32.500IDP92637 gene: yiaC; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b3550 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  15  1.....MIREAQRSELPAILELWLESTTWGHPFI--KANYWRDCIPLVRDAYLANAQ--NWVWEEDGKLLGFVSI---MEGRFLAAMFVAPKAVRRGIGKALMQYVQQ-----RHPHLMLEVYQKNQPAINFYQAQGFHIVDCAWQ..................... 128
51 -32.500IDP92633 gene: yafP; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b0234 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  10  1.MNNIQIRNYQPGDFQQLCAIFIRAVTMTASQHYSPQQISAWAQIDESRWKEKLAKSQVWVAIINAQPVGFISR----IEHYIDMLFVDPEYTRRGVASALLKPL-----IKSESELTVDA---SITAKPFFERYGFQTVK--QQRVECRGAWFTNFYMRYKPQ.. 149
52 -31.700IDP91769 gene: yjcK; ribosomal-protein-alanine acetyltransferase [Yersinia pseudotuberculosis IP 32953] YPTB1890 [Yersinia pseudotuberculosis IP 32953]  ali follow..  10  13.GKKIHLLVPDLSRSQEMHQLIVNFSNLHREFLADDNSSEETVFSNMSIASKNDEYKFLIINNHTNQLVGCISLFIRQIPYFEIGYWLSTQAMGYGFITEACILVRDLAHHLKSKRLEIRMARRNIRSSKLAERCGFYCEAILKNNRIDGFGCLDDTCIYIYSK.. 185
53 -30.700IDP95421 set236a-023 [Undefined organism]  ali follow..  21  27....................................................EVPRAAFVIARIDGFPVGCGALRPLDASTGEVRMYTRRGFRRKGVAQAILAELERLAIEFGYTTIKLQTGPKQLDAAALYELVGYHRIP......................... 116
54 -29.300IDP95424 set236a-026 [Undefined organism]  ali follow..  22  20....................................................AEPRGRLLLAYVDQKPAGCIALRGIDDGVCEMRLFVRDEFRGHRLGLLLVEKVIGEARAAGYLKMRLDTFPPKGKAVKLYESHGFREIAP--------YNNPHTGVLFMELDL. 127
55 -29.000IDP95401 set236a-066 [Undefined organism]  ali follow..  17  6..NEICIRTLIDDDFPLMLKWLTDERVLEFYGGRDKKYTLESLKKHYTEPWEDE--VFRVIIEYNNVPIGYGQIYKMYDEVYGMDQFIEPNYWSKGIGTRYIKLIFEFLKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHELHEGKKEDCYLMEYRYD.. 180
56 -28.400IDP91190 6`-aminoglycoside N-acetyltransferase [Enterococcus faecalis V583] EF_A0061 [Enterococcus faecalis V583]  ali follow..  17  6..NEICIRTLIDDDFPLMLKWLTDERVLEFYGGRDKKYTLESLKKHYTEPWEDE--VFRVIIEYNNVPIGYGQIYKMYDEVYGMDQFIEPNYWSKGIGTRYIKLIFEFLKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHELHEGKKEDCYLMEY..... 177
57 -28.100IDP92634 gene: yedL; predicted acyltransferase [Escherichia coli str. K-12 substr. MG1655] b1932 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  15  1.MFTIKTDDLTHPAVQALVAYHISGMLQQS----------PESSHALDVQKLRNPTVTFWSVWEGEQLAGIGALKLLDDKHGELSMRTAPNYLRRGVASLILRHILQVAQDRCLHRLSLETQAGFTACHQLYLKHGFADCEPFADYRL------DPHSRFLSLTL. 152
58 -27.200IDP00739 acetyltransferase, GNAT family SACOL1063 [Staphylococcus aureus subsp. aureus COL]  ali follow..  18  2.................FSKVNNQKMLEDCFYIRKKVFVEEQGVPEESEIDEYESESIHLIGYDNGQPVATARIRPINETTVKIEVAVMKSHRGQGMGRMLMQAVESLAKDEGFYVATMNAQCH---AIPFYESLNFKMRG......................... 123
59 -26.300IDP91819 gene: yjhQ; KpLE2 phage-like element; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4307 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  12  3.VHHFTFHITDKSDASDIREVETR------------AFGFSKEADLVASLLEDESPALSLLARYEGKAVGHILFTRSPLMHILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFV----------TYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSL. 158
60 -25.600IDP00844 acetyltransferase, GNAT family SACOL0519 [Staphylococcus aureus subsp. aureus COL]  ali follow..  2...QIYLSTLTELDYDKSLNSIEESFDDNPETSWQARAKVKH----LRKSPCYNFELEVIAKNENNDVVGHVLLIETYYGLAIASLSVHPELRGQKLGRGLVQAVEERAKAQEYSTVVV----------DYFEKLGYQNA----AEHDIKLEFGDAPLLVKYLW.. 156
61 -25.300IDP92639 gene: yhbS; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b3156 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  12  1....MLIRVEIPIDAPGIDALLRR------------SFESDAEAKLVHDLREDGFLTLGLVATDEGQVIGYVAFSPVDVQGEDLQLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVT----------ALYSRFGFELAA--HHDLRCRWPGTESAFQVHRLA.. 147
62 -25.000IDP92638 gene: yiiD; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3888 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  12  14SIAMYHLRVPQEEELERYYQFRWEMLRKPLHQPKGSERD------------WDAMAHHQMVVDEQGNLVAVGRLYINADNEASIRMAVHPDVQDKGLGTLMAMTLESVARQEGVKRVTCSARED---AVEFFAKLGFVNQG......................... 142
63 -23.800IDP95423 set236a-025 [Undefined organism]  ali follow..  16  1....MTEVVYTKGEFSISTDRSRIDLDLVHSFLSNSYWARNIPREVVRRSVEN---SLCFGVYEGVAQVGFARVLPDIATFAYLDVFILESHRGRGLSKWLVESILGHPDLQGLRRWML----ATRDAHGLYSKSGFVPL.......................... 130
64 -22.000IDP91818 gene: yfiQ; inhibiting acetyltransferase for acetyl-CoA synthetase [Escherichia coli str. K-12 substr. MG1655] b2584 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  12  724..ERCLFRPILPEDEPQLQQFISRVTKEDLYYRYFSEINEFTHEDLANMTQIDYDREMAFVAVRTEEILGVTRAISDPDNDAEFAVLVRSDLKGLGLGRRLMEKLITYTRDHGLQRLNGITMPNNRGMVALARKLGFNVD-----------IQLEEGIVGLTLNL. 880
65 -21.400IDP92635 gene: elaA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b2267 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  11  8.....HHSELSVSQLYALLQLRCAVFVVEQNCPYQD-----------IDGDDLTGDNRHILGWKNDELVAYARILKSDDDLEPVVIGVSEALRGEKVGQQLMSKTLETCTHHPDKPVYLGAQAH---LQNFYQSFGFIPVT......................... 133
66 -19.300CPX_01616_91817 Complex of sperminidine SpeG and DNA-binding response regulator RcsB [Undefined organism]  ali follow..  21  1MNSQLTLRALERGDLRFIHNLNNNRN--MSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEIIHRSAEFQIIIAPEHQGKGFARTLINRALDYSTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYI..... 163
67 -18.600IDP95397 set236a-062 [Undefined organism]  ali follow..  25  4.........................................................................................VDYWSKGIGTKYTKMIFEFLKERNADAVILDPHQDNPRAIRMYQKAGFRIIEDLPEHELHEGKKEDCYLM....... 74
68 -14.400IDP92022 glycylpeptide N-tetradecanoyltransferase, putative [Toxoplasma gondii ME49] TGME49_009160 [Toxoplasma gondii ME49]  ali follow..  126....CECDVRDPEELKEVYDLLSQHYVEDDDNLFRFNYSADFLDWALTAPGCHRDWVIGVRVSSTNKLVGFITATPSVPMAEVNFLCVHKKLRSKRLAPVLIKEITRRVNLRSIWQAVYTAGVVLPTPVAQCRYWHR............................. 266
69 -13.600IDP92641 gene: yjdJ; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b4127 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  16  4....................................................REGHNKFYINDKQGKQIAEIVFVPTGENLAIIETDVDESLKGQGIGKQLVAKVVEKMRREKRKIIPL............................................... 71
70 -13.300IDP92630 gene: argA; fused acetylglutamate kinase homolog (inactive)/amino acid N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b2818 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  20  298......IRRATINDIGGILELIRPLEQQGILV--------RRSREQLEMEIDK-----FTIIQRDNTTIACAALYPFPEEGEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFV-----TTRSIHWFQERGFTPVDI........................ 418
71 -13.000IDP90696 gene: argA; N-acetylglutamate synthase [Yersinia pestis CO92] YPO1022 [Yersinia pestis CO92]  ali follow..  18  297......VRRATINDIGGILELIRPLEQQGILV--------RRSREQLEMEIDK-----FTIIERDNLTIACAALYPFPDEGEMACVAVHPDYRSSSRGEMLLNRITNQARQMGLKKLFV-----TTRSIHWFQERGFTPAEV........................ 417
72 -10.300IDP95449 set236a-051 [Undefined organism]  ali follow..  10  5..KRVSFRPMSEDDLVLMLKWLTDDRVLEFYDGRDKKHTQKTIREHYTEQ--WADEIYRVIIEYDTIPIGYAQIYRIQGE...................................................................................... 80

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.