current user: public

If you have questions about the server, please let us know.

Query: IDP06042 hypothetical protein jhp0369 [Helicobacter pylori J99] NP_223088 [Helicobacter pylori J99], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MGINMCSKKIRNLILCFGFILSLCAEENITKENMTETNTTEENTPKDAPILLEEKRAQTLELKEENEVAKKIDEKSLLEEIHKKKRQLYMLKGELHEKNESILFQQMAKNKSGFFIGVILGDIGINANPYEKFELLSNIQASPLLYGLRSGYQKYFANGISALRFYGEYLGGAMKGFKSDSLASYQTASLNIDLLMDKPIDKEKRFALGIFGGVGVGWNGMYQNLKEIRGYSQPNAFGLVLNLGVSMTLNLKHRFELALKMPPLKETSQTFLYYFKSTNIYYISYNYLLLast
1 -106.000IDP06042 hypothetical protein jhp0369 [Helicobacter pylori J99] NP_223088 [Helicobacter pylori J99]  ali  100  1MGINMCSKKIRNLILCFGFILSLCAEENITKENMTETNTTEENTPKDAPILLEEKRAQTLELKEENEVAKKIDEKSLLEEIHKKKRQLYMLKGELHEKNESILFQQMAKNKSGFFIGVILGDIGINANPYEKFELLSNIQASPLLYGLRSGYQKYFANGISALRFYGEYLGGAMKGFKSDSLASYQTASLNIDLLMDKPIDKEKRFALGIFGGVGVGWNGMYQNLKEIRGYSQPNAFGLVLNLGVSMTLNLKHRFELALKMPPLKETSQTFLYYFKSTNIYYISYNYLL 289
2 -66.200IDP06043 hypothetical protein jhp0370 [Helicobacter pylori J99] NP_223089 [Helicobacter pylori J99]  ali follow..  22  1....MKLK---YWLVYLAFIIGLQATDYDNLEEENQQLDEKINNLKRQ-----------------LTEKGVSPKEMDKDKFEEEYLERTYPKISSKKRKKLLKSFSIADDKSGVFLGGGYAYGELNLSYQSAFKNNININAPVSMISVKFGYQKYFVPYF-GTRFYGDLLLGGGALKQPVGSFFYVLGAMNTDLLFDMPLDKTKKHFLGVYAGFGIGLMLYQDKSSPNFLWKSLIEVDYTFNVGVSLTLYRKHRLEIGTKLPISYLRMGSANNQFKRSSFLLVNYAFIF 313
3 -65.500IDP06040 hypothetical protein jhp0368 [Helicobacter pylori J99] NP_223087 [Helicobacter pylori J99]  ali follow..  21  1MGL---KKRAILWSLMGFCAGLSALDYDTL-------------------------------------------------DPKYYKYIKYYKAYEDKEVEELIRDLKRANAKSGLILGINTGFFYNHEIMTNSSSITGNILNYLFAYGLRFGYQTFRPSFF-ARLVKPNIIGRRIYIQAGFGSVGFQSVMLNGDFLLDFPLPFVGKYLMGGYMGLGLGVVAH--------GVNYTAEWGMSFNAGLALTVLEKNRIEFEFKILNNFPFLQSNSKETWWGAIASIGYQYVF 240
4 -26.400IDP00165 gene: acfA; accessory colonization factor AcfA VC0844 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  1..............................................................................................MQKTLSAIFLFTTLSANAAPYIGLELGIGTANHSFETNDAVSLNPNMEDMFLGGLIGYK--FNDNFSFEINYSSYKLEDQYSKEHEWSSEIEAKQLALISVYSYPIHQQ----LKTNIKVGVTHTQYEAYSGKYETGLKKNRFGALFSLGLDYNLIPELSVGTELR----------QFDKYNDVLSISLNSKYYF 215
5 -21.700IDP90997 gene: ompX; outer membrane protein X [Yersinia pestis KIM 10] y1682 [Yersinia pestis KIM10+]  ali follow..  10  1.......................................................................................MVMKKIACLSAVAACVLAVTAGSAFAGQSTVSGGYAQSDYQ---------GVANKSSGFNLKYRYE--WSDSQLGYITSFTHT-EKSGFGDEAVYNKAQYNAITGGPAYRI------NDWASIYGLVGVGHGRFTQNESAFGDKHSTSDYGFTYGAGLQFNPAENVALDVSYEQ---------SRIRNVDVGTWVAGVGYTF 176
6 -21.200IDP01854 gene: pagC; virulence membrane protein PAGC precursor [Salmonella typhimurium LT2] STM1246 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  7..............................................................................................STLVITTSVLVVNVAQADTNAFSVGYAQS------------KVQDFKNIRGVNVKYRYE--DDSPVSFISSLSYLYGDRQASEGIHYHDKFEVKYGSLMVGPAYRLSDN----FSLYALAGVGTVKATFKEHSTQDKISSRKTGFAWGAGVQMNPLENIVVDVGYE----------SNISSTKINGFNVGVGYRF 185
7 -12.900IDP02013 gene: pgtE; outer membrane protease [Salmonella typhimurium LT2] STM2395 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  1......MKKAIAVMMIAVFSESVYAESALFIPDVSPDSVTTSLSVGVLNGKSRELVYDTDTGRKLSQLD---------KIKNVATLQGDLSWEPYSFMTLDARGWTSLASGSGHMVDHD--MSSEQPGWTDRSIHPDTSVNYANEYDLNVKGWLLQGDNYK-AGVTAGYQETRFSWTARGGSYIYDNGRYIGNFPHGVRGIGYSQRFEMPYIGLAGDYRI----RKLTFREKTENSRYYGASIDAGYYITSNAKIFAEFAYSKYEEGKGGTQIIDNNNYTVTAGLQYRF 312
8 -12.900IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames]  ali follow..  18  1M-----LKKLGILVLGSAVALSLVACGDSTKEASNEKKEEPKQEAKKENKENKESKKKITAADVEAIKVGDSLTGAGGEKYEDVVAKFGEPDNKAESQAGDIKMIIASWTKNV-------GDLGANFNVTFTEKDGQKLATSKAQMGMK............................................................................................................................................ 138
9 -12.500IDP91023 hypothetical protein y2980 [Yersinia pestis KIM 10] y2980 [Yersinia pestis KIM10+]  ali follow..  1..........................................................................................MNKHLVACAASLLLVAGSASAVSFNAETGRHYTNLGFGLGTNTGGLARSDHDGDVLGLGLGFNLPVGPMTATVG-------AKGIYMSPEDGSSGGAVAIGGGLSYPI------NKSFSVYGEGYFAPEELTSGMKSY----------SEANGGVRWNVFRPLTVDVGYRY--INMEGKEGRRDNRLADGVYIGAGLNF 180
10 -12.000IDP01391 outer membrane protein OmpU VC0633 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  5LGLNKMNKTLIALAVSAAAVATGAYADGINQSGDKAGSTVYSAKGTSLEVGGRAEARLSLKDGKAQDNSRVRLNFLGKAEINDSLYGVGFYEGEFTTNDQGKNASNNSLDNRYTYAGIGGTYGEVTIAVADRVDNMLAYKGQFGDLGVKASYRDNGEDGYSLSAIYTFGDTGFNVGAGYADQDDQNEYMLAASYLFTDGELAKDVDYTGYELAAGYKLGQAAFTATYNNAETAKETSADNFAIDATYYFKPNFRSYISYQF---NLLDSDKVGKVASEDELAIGLRYDF 350
11 -11.600IDP05677 hypothetical protein lmo1068 [Listeria monocytogenes EGD-e] lmo1068 [Listeria monocytogenes EGD-e]  ali follow..  14  1......MKKWMVIISIISLVALLGACGNNDNEKDQEDKSTTDSTTKKAKSSSNESNKAAETKENDTNDKAATTDKGSSNPTKEEKDTSTTTDTPKKETPKSPAKTEAFSFSPSGFKVSTVESILGGDVTTTYLSSSKSFQKDFEALTLFIQYK........................................................................................................................................ 148
12 -11.400IDP92694 TpgX protein [Staphylococcus aureus subsp. aureus ST398] YP_005735174 [Staphylococcus aureus subsp. aureus ST398]  ali follow..  13  1......MKKLVTGLLALSLFLAACGQDSDQQKDSNKEKDDKAKTEQQDKKTNDSSKDKKDNKDNSKDVNKDNKDNSANDNQQQSNSNATNNDQNQTNNNQSNSGQTTNNQKSS................................................................................................................................................................................ 107
13 -11.300IDP02672 hypothetical protein FTT1602 [Francisella tularensis subsp. tularensis SCHU S4] FTT1602 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  10  1......MKKQLFAISITTALLVLSACGQTGPLYLPDEDKLNSGSTLAKSGSSIMVKQNQQNNSTSTSDNQSDTSTKVDNDPTAPVRNNNPTTSELFEGENNFNYNNNIQNSQN................................................................................................................................................................................ 107
14 -11.300IDP05121 conserved hypothetical protein [Bacillus anthracis str. Ames] BA_0915 [Bacillus anthracis str. Ames]  ali follow..  16  1M-----LKKFTTCILGGALVFNLSGDKTSSESKETNSKQEEKNVQTTDEAKTKENTKQKNTEQTKEKSKIKEKEYAVNKDFHTPKFDVTVKRVVERDKVGKESIGFQKPEDGHVFIVVEAEGKNITSEPMK.............................................................................................................................................................. 131
15 -11.200IDP04197 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_2510 [Clostridium perfringens ATCC 13124]  ali follow..  14  1......MKKLLVPVLVIIIFALLFVGCTNSSNSSSDSSVEIINSNQQNSNSNNNNSSNNDTKKSDSNNASHKDNKDNNVSNNKNTNK------KLDNKAEKLLKDIKEKAVKGEIIDYDFKLGDSIYDVIDKLGKPSSENYVAEAKGNYFNFDS....................................................................................................................................... 142
16 -11.000IDP05395 putative lipoprotein [Bacillus anthracis str. Ames] BA_2942 [Bacillus anthracis str. Ames]  ali follow..  18  1....MNYKKMLSIFMTSIFTVGLLIGCNPAPKDEKEPDPTEEPSEQRQEEKNEKQDPAKEQNNELNKKDEQEPDPTEEPSEEQKKKK.......................................................................................................................................................................................................... 83
17 -10.600IDP01448 outer membrane protein OmpA VC2213 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  2............................................................................................KKLAAIISATLLFASSAAVAEVYVGGKVGKSWLD----DACLAGQSCEDDDQVVGAFLGYQ--ANKWLS-----LEAGYDYLGKFTAAGLNDEKVQAVTLAPKLSIPLTEG----IALYGKVGGAYVDY----------GSKDDYSYLGAAGLEFNTNHNVTMRLEYQN----LTDINNDIVRARAETATLGIAYKF 169
18 -10.400IDP05012 cell wall surface anchor family protein [Bacillus anthracis str. Ames] BA_5070 [Bacillus anthracis str. Ames]  ali follow..  12  1......MKKKLLPICAIALLTSVASADTGTVTKEEATQLQQDKAKKEAAIKEQQKIEEEKKRIAQEQLKNDMAKKEEAIKAQQKSEEGKKEAAQVQPKNAATKKEVAKPAVQG-----------------EKLPNTASNNVAMMALSVGIGTLFGLKRR.................................................................................................................................. 143
19 -10.400IDP04210 ZZZ_0017 [Escherichia coli O157:H7 str. EDL933]  ali follow..  1MNVSSLFPTVNRNITAVYKKSSFSVSPQKITLNPVKISSPFSPSSSSISATTLFRAPNAHSASFHRQSTAESSLHQQLPNVRQRLIQHLAEHGIKPARSMAEHIPPAPNWPA................................................................................................................................................................................. 114
20 -10.200IDP91038 hypothetical protein SAHV_2481 [Staphylococcus aureus subsp. aureus Mu3] SAHV_2481 [Staphylococcus aureus subsp. aureus Mu3]  ali follow..  11  23.....SIRKFASILIGSLMYLGTQQEAEAAENNIENPTTLKDNVQSKEVKIEEVTNKDTAPQGVEAKSEVTSNKDTIEHEASVKAEDISKKEDTPKEVANVAEVQPKSSVTHN----VRKARSVDEGSFDITRDSKNVVESTPITIQGKEHFEGYGSVDIQKNPTDLGVSEVTRFNVGNESNGLIGALQLKNKIDFSKDFNFKVRVANN---GWGFLFSKGNAEEYLTNGG----------ILGDK---------SGGFKIDTGYIYTSSMDKTEKQAGQGYRGYAFV. 302
21 -10.100IDP90313 gene: ompB; Outer Membrane Protein Analog [Chlamydia trachomatis D/UW-3/CX] CT_713 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  1MS-SKLVNYLRLTFLSFLGIASTSLDAMPAGNPAFPVSEEAQVKDVPVVTSVTTAGVGPSPDITSTTKTRNFDLVNCNLNTNCVAVAFSLPDRSLSAIPLFDVSFEVKVGGLKQYRDFTSEPLNSESEVTDGMIEVQSNYGFVWDVSLKVGADYRHASCPIDYIIANSQANPEVFIADSDGKLNFKEWSVCVGLTTYV------NDYVLPYLAFSIGSVSRRFTNLKFKVRKITSSHRGNICIGATNYVADNFFYNVEGRW---------------SQRAVNVSGGFQF 340
22 -9.990IDP05267 hypothetical protein lmo0255 [Listeria monocytogenes EGD-e] lmo0255 [Listeria monocytogenes EGD-e]  ali follow..  10  1......MKKFLSILSILVLALLVTACGSDSSDKKSAKKEEKMETVTYIADINGAKLEATFSHVGDNLRKVDQKMVYPLTALGLESGANLDDATKKQLEEQVASQYSAYKESKGA............................................................................................................................................................................... 108
23 -9.990IDP05442 putative lipoprotein [Bacillus anthracis str. Ames] BA_0171 [Bacillus anthracis str. Ames]  ali follow..  1M------KKLLSLFSAVIVAAFVITGCGQSDTTNKEQKENAAKENKTEKTDTTKENKPEEKNPKTRKLKIKRRKIP..................................................................................................................................................................................................................... 71
24 -9.920IDP01900 gene: apeE; outer membrane esterase [Salmonella typhimurium LT2] STM0570 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  461.............................................................................................................RAGQAWLDSDLHFLSAKFSNIQRRVEEGETNGRLWGARLTSGYDFVMVPWLT----MLQYAWDYSHVNGYSEK------NTSTSMRFGDQNAHSQVGSAGWRLDLRHS-RQFGDDTYVANGGLKSTALTFSIAIGADFPLSATVSAFAGLS--------QTAGLSDGNQTRYNVGFSARF 656
25 -9.760IDP05596 putative lipoprotein [Bacillus anthracis str. Ames] BA_3366 [Bacillus anthracis str. Ames]  ali follow..  11  1M---SKMKWFISLLLSLGLLAGCEEAAVKLEKKVEPKQEEVAKQEEKKDEAKPEEKPEEKQAEQEQNKQDEQKEKQEQKVEEKPKEEKPQAQLEVKKEEKQQEQPKEQPAVN................................................................................................................................................................................. 109
26 -9.580IDP05117 putative collagen-binding protein [Clostridium difficile 630] CD2831 [Peptoclostridium difficile 630]  ali follow..  10  1......MKK-KALLISLIMILSMVVSTTVSYASELGENSQIQSGSTNSSTGEEKESDNKKPEQTPEKDKATDNKKPEQTPEEEKPTDNKKPEQTPEEDKSTDNKKPEQTPEG................................................................................................................................................................................. 111
27 -9.400IDP06510 WxL domain surface protein [Enterococcus faecium DO] AFK58238 [Enterococcus faecium DO]  ali follow..  13  1MN--QCVKKLILFVFPLLMVTSVFADVEKTNESTQSENQSFDKTTFSEESITSETTESQSEASTNKRQEENKTSETSEVAEQTSDSSEAALARAVSADGYSEAATQLLADESVTKIRLIQPLT-LDRELEIKRDIVIDFGGFAHNFG.............................................................................................................................................. 152
28 -9.190IDP01898 invasin-like protein [Salmonella typhimurium LT2] STM1669 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  1..MVFSKKPITKYITWAIVTSQIPLPVIADSDNEIQSWIAGTASSISPHLQEGTLEDYAKGKIKALPGQAANHLVNEGIKSAFPEIIFRGDGAKYRSSEFDMFIPVQETTSSLLFGQLGF----------RDHDNSSFDGRTYVNVGM--GYRQEVNGWLLGVNTFLDADIRYSHLR----------GGIGGEVYKDSLAFSGNYY--GF-FSGELTYEQYYGDKVDLLGNGTLSRNPRAAGAALVWNPVPLLEVRAGYR----------DAGNGGSQAEGGLRVNYSF 291
29 -9.130IDP04414 gene: sepA; SepA, extracellular serine protease of the IgA1 protease family, secreted by a C-terminal autotransporter domain [Shigella flexneri] CAC05786 [Shigella flexneri]  ali follow..  10 1178..............................................................................................................NSGAYFDLIGKYLHHDNTANFASLGTKDYSSHSWYAGAEVGYRYHLTKESW----QIELVYGSVSGKAFSWEDRGMALSMKDK-------YNPLIGRTGVDVGRAFNGETVLQDASGEKRFEGEKDSRMLMTVGMNAEIKDNMRLGLELE--------KSAFGKYNVDNAINANFRYVF 1364
30 -9.120IDP05451 putative lipoprotein [Bacillus anthracis str. Ames] BA_0580 [Bacillus anthracis str. Ames]  ali follow..  15  1......MKKIGTMLLFSILIAGCTQAQPDLKKPKKEAIATSSTQVNAPSFFHLSVLKDVNWEETPSFIQEKIPLKGIEEKIAMADSPIIANEKN-PEMPTGKLSIIALKQGSVTPTPLLFQQESSEPTWTTSNTIDSTTNELPLTMSLSSGLNIYVNEKYYD............................................................................................................................... 167
31 -9.080IDP04017 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1035 [Clostridium perfringens ATCC 13124]  ali follow..  14  1......MRKLVSLLLSIGILSGAFIGCGRNNQKEVSDNENSSNISNEEKNNKEVKNDNNDKKESKDSENDTKDNKDKNEQRDKEDLNKENMKEERDPKLDESVIVNNGIIII................................................................................................................................................................................. 106
32 -9.000IDP91022 gene: ompC; outer membrane porin protein C [Yersinia pestis KIM 10] y2966 [Yersinia pestis KIM10+]  ali follow..  11  1......MITMKLRVLSFIIPALLVAGSASAAEIYNKDGNKLDLYGKIDGLHYFSDNKNLDGDQSYMR--------KGETQITDQLTGYGQWEYQVNLNKAENEDGNHDSFTRVGFAGLKLQYQGKNGSSSETNNGRGVADQNGDGYGMSLSYDL-GGLKYDANNVYLAANYTQTYNLTRFGDFSNRSSD-NIEVVAQYQFDFGLRPSVA-----------YLQSKGKDIGIYGDQDLLKYVDIGATYFFNKNMSTYVDYKINLLDKNDFTKNARINTDDIVAVGMVYQF 374

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.