current user: public

If you have questions about the server, please let us know.

Query: IDP06043 hypothetical protein jhp0370 [Helicobacter pylori J99] NP_223089 [Helicobacter pylori J99], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst MKLKYWLVYLAFIIGLQATDYDNLEEENQQLDEKINNLKRQLTEKGVSPKEMDKDKFEEEYLERTYPKISSKKRKKLLKSFSIADDKSGVFLGGGYAYGELNLSYQGEMLDRYGANAPSAFKNNININAPVSMISVKFGYQKYFVPYFGTRFYGDLLLGGGALKENALKQPVGSFFYVLGAMNTDLLFDMPLDFKTKKHFLGVYAGFGIGLMLYQDKPNQNGRNLIVGGYSSPNFLWKSLIEVDYTFNVGVSLTLYRKHRLEIGTKLPISYLRMGVEEGAIYHNKENDERLLISANNQFKRSSFLLVNYAFIFLast
1 -103.000IDP06043 hypothetical protein jhp0370 [Helicobacter pylori J99] NP_223089 [Helicobacter pylori J99]  ali  100  1MKLKYWLVYLAFIIGLQATDYDNLEEENQQLDEKINNLKRQLTEKGVSPKEMDKDKFEEEYLERTYPKISSKKRKKLLKSFSIADDKSGVFLGGGYAYGELNLSYQGEMLDRYGANAPSAFKNNININAPVSMISVKFGYQKYFVPYFGTRFYGDLLLGGGALKENALKQPVGSFFYVLGAMNTDLLFDMPLDFKTKKHFLGVYAGFGIGLMLYQDKPNQNGRNLIVGGYSSPNFLWKSLIEVDYTFNVGVSLTLYRKHRLEIGTKLPISYLRMGVEEGAIYHNKENDERLLISANNQFKRSSFLLVNYAFIF 313
2 -68.000IDP06040 hypothetical protein jhp0368 [Helicobacter pylori J99] NP_223087 [Helicobacter pylori J99]  ali follow..  19  1MLKKRAILWSLMGFCAGLSALDYDTLDPKYYKYI-----------------------------KYYKAYEDKEVEELIRDLKRANAKSGLILGINTGFFYNHEIMVKT----------NSSSITGNILNYLFAYGLRFGYQTFRPSFFARLVKPNIIGRRIYIQGAPKKAGFGSVGFQSVMLNGDFLLDFPLPFVGKYLYMGGYMGLGLGVVAHGVN---------------------YTAEWGMSFNAGLALTVLEKNRIEFEFKILNNFPFLQ-----------------SNSSKETWWGAIASIGYQYVF 240
3 -66.200IDP06042 hypothetical protein jhp0369 [Helicobacter pylori J99] NP_223088 [Helicobacter pylori J99]  ali follow..  22  5MCSKNLILCFGFILSLCAEENITKENMTETNTTEENTPKDANEVAKKIDEKSLLEEIHKKKRQLYMLKGELHEKNESILFQQMAKNKSGFFIGVILGDIGINANPY------------EKFELLSNIQASPLLYGLRSGYQKYFANGIALRFYGEYLGGAMK-----GFKSDSLASYQTASLNIDLLMDKPID-KEKRFALGIFGGVGVGWNGMYQN-------------LKEIRGYSQPNAFGLVLNLGVSMTLNLKHRFELALKMPPLKETSQ------------------TFLYYFKSTNIYYISYNYLL 289
4 -24.100IDP00165 gene: acfA; accessory colonization factor AcfA VC0844 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  1......................................................................MQKTLSAIFLFTTLSANAAPYIGLELGIGTANHSFETNY---------QSDAVSLNPNMEDMFLGGLIGYK--FNDNFSFEIYSSYKLEDQYSKQQYRKEHEWSSEIEAKQLALISVYSYPIH------QLKTNIKVGVTHTQYEAYSGKYEELELLLNDDIELETGLKKNRFGALFSLGLDYNLIPELSVGTELR----------------------------QFDKYNDVLSISLNSKYYF 215
5 -18.800IDP01854 gene: pagC; virulence membrane protein PAGC precursor [Salmonella typhimurium LT2] STM1246 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  13............................................................................TSVLVVNVAQADTNAFSVGYAQS------------------------KVQDFKNIRGVNVKYRYE--DDSPVSFISLSYLYGDRQASGSVEPEGIHYHDKFEVKYGSLMVGPAYRLS------NFSLYALAGVGTVKATFKEHST-------QDGDSFSNKISSRKTGFAWGAGVQMNPLENIVVDVGYE---------------------------GSNISSTKINGFNVGVGYRF 185
6 -17.300IDP02013 gene: pgtE; outer membrane protease [Salmonella typhimurium LT2] STM2395 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  1..MKKHAIAVMMIAVFSESVYAESALFIPDVSPDSVTTSLSVGVLNGKSRELVYDTDTGRKLSQLDWKIKNVATLQGDLSWEP---YSFMTLDARGWTSLASGSVDHDWMSSEQPGWTDRSIHPDTSVNYANEYDLNVKGWLLQGDNYKAGVTAGYQETRFSWTARGGSYIYDNGRYIGNFPHGVRGIGYSQRFE------MPYIGLAGDYRIFKYSDWVNAHDNDEHYMRKLTFREKTENSRYYGASIDAGYYITSNAKIFAEFAYSKYEEGKGGTQIIDKTSGDTAYFGGDAAGIANNN-YTVTAGLQYRF 312
7 -14.900IDP90997 gene: ompX; outer membrane protein X [Yersinia pestis KIM 10] y1682 [Yersinia pestis KIM10+]  ali follow..  10  1MVMKKIACLSAVAACVLA---------------------------------------------------------------VTAGSAFAGQSTVSGGYAQSDYQ---------------------GVANKSSGFNLKYRYE--WSDSQLGYI-TSFTHTEKSGFGDEAVYNKAQYNAITGGPAYRI-----------NDWASIYGLVGVGHGRF------------TQNESAFVGDKHSTSDYGFTYGAGLQFNPAENVALDVSYEQ---------------------------SRIRNVDVGTWVAGVGYTF 176
8 -12.100IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames]  ali follow..  15  1MLKKLGILVLGVALSLVACGDSTKEASNEKKEEPKQEAKKENKENKESKKKITAADVEAIKVGDSLTGAGGEKYEDVVAKFGEPDNKA------------------ESQAGDIKMIIASWTKNVNGDLGANFNVTFTEKKLATSKAQMGMK.................................................................................................................................................................. 138
9 -11.100IDP01900 gene: apeE; outer membrane esterase [Salmonella typhimurium LT2] STM0570 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  435...........................................................SLDKQHPDDNYRYDARGFQAAVFSHLRAGQAWLDSDLHFLSAKF----SNIQRSITLGALRRVEEGETNGRLWGARLTSGYDFVMVPWLTTGPMLQYAWDYSHVNGYSEKLNTS------TSMRFG------QNAHSQVGSAGWRLDAQINYRRQFGDDTYVANGGLKSTALTFSRDGKTQDKNWVDIAIGADFPLSATVSAFAGLS--------------------------QTAGLSDGNQTRYNVGFSARF 656
10 -10.600IDP04414 gene: sepA; SepA, extracellular serine protease of the IgA1 protease family, secreted by a C-terminal autotransporter domain [Shigella flexneri] CAC05786 [Shigella flexneri]  ali follow..  12 1071............AKDFMASGYKSFLTEVNNLNKRMGDLRDTQGDAGVWARIMNGTGSADGDYSDNYTHVQ------IGVDRKHELDGVDLFTGALLTYTDSNASSHAFSGKDNQHTANFASLGTKDYSSHSWYAGAEVGYRYHLTKESWVEPQIELVYGSVS---------GKAFSWEDRGMALSMKDK---DYNPLIGRTGVDVGRAFSRAGLGYQFDLLANGETVLQDASGEKRFEGEKDSRMLMTVGMNAEIKDNMRLGLELE--------------------------KSAFGKYNVDNAINANFRYVF 1364
11 -9.660IDP91023 hypothetical protein y2980 [Yersinia pestis KIM 10] y2980 [Yersinia pestis KIM10+]  ali follow..  10  1MN-KHLVACAASLLLVAGSASAVSFNAETGRHYTNLGFGLGTNTGGLAIS--------------------------------ARSDHDGDVLGLGLGFNLPVGPMTATVGAKGIYM-----SPEDGSSGGAVAIGGGLSYP--INKSFSVYGEGYFAPEELTSGMKSYSEANGGVRWLTVDVGYRYIMEGKEGRRDNRLADGVYIGAGLNF...................................................................................................... 180
12 -9.530IDP05121 conserved hypothetical protein [Bacillus anthracis str. Ames] BA_0915 [Bacillus anthracis str. Ames]  ali follow..  1MLKKFTTCILGGALVFNLSGCGNTSDKTSSESKETNSKQEEKNVQTTDEAKTKENTKQKNTEQTKEKSKIKEKEYAVNKDFHTKPEDGHVFIVVEAEGKNITSEPMKLAFLPSVDLVDENDNAYQSDVWAASSYDVEKGETSSITKELGEVKRQNKVY........................................................................................................................................................... 184
13 -9.080IDP01898 invasin-like protein [Salmonella typhimurium LT2] STM1669 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  1MVFSKKPITKYITWAIVTSQIPLPVIADSDNEIQSWIAGTASSISPHLQEGTLEDYAKGKIKALPGQAANHLVNEGIKSAFPEIIFRGGVNLEDGAKYRSSEFDQETTSSLLFGQLGFRDHDNSSFDGRTYVNVGM--GYRQEVNGWLGVNTFLDADIRYSHLR---------------GGIGGEVYKDSLAFSGNYYFPLGF-FSGELTYEQYYGDKVDLLGNGTLSRNPRAAGAALVWNPVPL-LEVRAGYRDAGNGGSQAEGGLRVNYSFGTPLHEQLDYRNVGAPSNTTNRRAFVDRNYDIVMAY.... 327

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.