current user: public

If you have questions about the server, please let us know.

Query: IDP06051 gene: hlyA; hemolysin [Helicobacter pylori J99] NP_223058 [Helicobacter pylori J99], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst MRLDYALFNQHLANSREKAKALVLKKQVLVNKMVVSKPSFIVKEGDQIELIAPNLFVSRAGEKLGAFLEDHFIDFKEKVVLDVGASKGGFSQVALLKGAKKVLCVDVGKMQLDESLKNDQRIECYEECDIRGFKTPEKIDLALCDVSFISLYCILEAILPLSGEFLTLFKPQFEVGRTIKRNKKGVVMDKEAILNALENFKNHLKTKDFQILTIQESLVKGKNGNVEFFIHFKRALast
1 -107.000IDP06051 gene: hlyA; hemolysin [Helicobacter pylori J99] NP_223058 [Helicobacter pylori J99]  ali  100  1MRLDYALFNQHLANSREKAKALVLKKQVLVNKMVVSKPSFIVKEGDQIELIAPNLFVSRAGEKLGAFLEDHFIDFKEKVVLDVGASKGGFSQVALLKGAKKVLCVDVGKMQLDESLKNDQRIECYEECDIRGFKTPEKIDLALCDVSFISLYCILEAILPLSGEFLTLFKPQFEVGRTIKRNKKGVVMDKEAILNALENFKNHLKTKDFQILTIQESLVKGKNGNVEFFIHFKRA 235
2 -95.200IDP05733 putative RNA methyltransferase [Clostridium difficile 630] CD1208 [Peptoclostridium difficile 630]  ali follow..  37  3KRIDLLLVEQGYFESRERAKKAIMAGLVFVDNQRCDKAGTEVKEDCSIVKGNPIPYVSRGGLKLEKAMKNFDLTIDGKVCMDIGASTGGFTDCMLKNGAIKVFSIDVGYGQLAWKLRQDDRVVCMERTNIRNVTIEQFADFASIDVSFISLKLVLPKAVRHDGEVVALIKPQFEAGRE-KVGKKGVVREKSTHIEVIKMISDFSVENGFEILGLDFSPIKGPEGNIEYLIHLRNG 243
3 -95.000IDP04727 hemolysin A [Clostridium perfringens ATCC 13124] CPF_2072 [Clostridium perfringens ATCC 13124]  ali follow..  37  9ERLDVLLVEQGIAESREKAKRYIMAGMVFIGEKRVDKAGEKVPVSSNIFRGEKLPFVSRGGFKLDKAVKSFGIDLKGKRCLDIGASTGGFTDCMLQNDASKVFSIDVGYGQFAWKLRVDPRVVCMERTNVRYVTPEELCDFASIDVSFISLTTVLPAVLNDKGEVMALIKPQFEAGRE-KVGKKGVVREASTHKEVIKKIVDFALSHKLNILGLDFSPIKGPEGNIEYLIYLKKD 249
4 -94.300IDP00061 hemolysin A BA_4399 [Bacillus anthracis str. Ames]  ali follow..  34  6ERVDVLLVERGLIETREKAKRAIMAGLVYANEMRLDKPGEKIPQDTEITVGQVMPYVSRGGYKLEKALETFHLDLQDKVMIDIGSSTGGFTDCALQNGAKLSYALDVGYNQLAWKLRQDERVVVMERTNFRYVTPAGLPQFASIDVSFISLKLILPVLLMPNGDVAALIKPQFEAGRE-QVGKKGIVRDRKVHEAVVEMIVDFAIKEGYDVEGLTFSPITGGDGNIEFLIHLKWH 247
5 -13.600IDP90550 gene: rpsD; 30S ribosomal protein S4 [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1594 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  38  99.RLDNIVYRMGFATTRRFARQLVTHGHVLVNGKRVDIPSFRVEAGAKIEIIEKSK.................................................................................................................................................................................... 152
6 -13.400IDP91404 ribosome-associated heat shock protein implicated in the recycling of the 50S subunit [Vibrio vulnificus CMCP6] VV1_0879 [Vibrio vulnificus CMCP6]  ali follow..  32  8VRLDKWLWAARFYKTRSIARDMVDGGKVHYNGQRA-KPSKIVEVGAVLKL......................................................................................................................................................................................... 56
7 -13.100IDP01031 gene: yrfH; ribosome-associated heat shock protein Hsp15 STM3497 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  28  9VRLDKWLWAARFYKTRAMAREMIEGGKVHYNGQRS-KPSKIVELNATLTL......................................................................................................................................................................................... 57
8 -12.800IDP92092 ribosomal RNA large subunit methyltransferase J, putative [Toxoplasma gondii ME49] TGME49_020940 [Toxoplasma gondii ME49]  ali follow..  18  128...........................................TDRYVLRAQERNLRSRAAFKLEQLDDDFLFFRKNQVVVDLGAYPGGWSQVALDR-EGRVIAVDPHHTFIQGSVGQAG------LQALLEELGESKADVVLSDMA-----ACIGVKQDDHLNCAELCLFASDLMEQ-VLKLGGTFVTKMFMGSETNNFKVYLRTRFKKVS--SAKPRACRQESREMYFVCQH. 318
9 -12.600IDP00274 gene: N/A; NS5 methyl transferase and RNA polymerase AF180817_2494-3392 [Dengue virus 1]  ali follow..  17  16.QLNQL--------SKSEFNTYKRSGIMEVDRSEAKEGLKRGETTKHA--------VSRGTAKLRWFVERNLVKPEGKV-IDLGCGRGGWSYYCGLKKVTEVKGYTKGPGHEEPIPMATNLVKLHSGKDVFFIP-PEKCDTLLCDIGTLRVLKMVEPWLRGNQFCIKILNP--------------------YMPSVVETLEQMQRKHGGMLVRNPLS----RNSTHEMYW..... 219
10 -11.200IDP02131 methyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1419c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  21  36........................................................................VGKKDIKVADIGAGTGNLSIMLLERGCK-VVSVEPNDAMREIGIEKDQKIDWVRATGLNSTLQNSEFDWVTFGSSF-EALEEAHRLLKSEGYFSCM................................................................... 137
11 -10.900IDP92740 hypothetical protein lpp2134 [Legionella pneumophila str. Paris] YP_124446 [Legionella pneumophila str. Paris]  ali follow..  14  4...................................................DPERYVLGNYIQNKINDVFLKT--LSGNILDIGCGDGHYTSLLAGKKHGQVLGIDSSEQMIMHANQQWAR-LSFEVHNIEEFHQPQSFDLALSFLHWTNIHISFPNILKREGKLYAVMSSF-ELAKQNLYRDLTEQYISPINEQYFYGVINLLNRLPFKRIKLDLKTCRVHLPHIDYYKNLLLT 205
12 -10.800IDP92743 hypothetical protein lpp2747 [Legionella pneumophila str. Paris] YP_125052 [Legionella pneumophila str. Paris]  ali follow..  17  19..................................................AKGNYILREISSKFLAKISI-----SNDYLLDAGCGDGSFTQMLANLPDGYVLGLDRSKTMIDYANKHCRS-VRFDIGDIQEPIIYGPFDNILSFLHWTDLEKSLSNLLKPGGKICAIVLNSLQFQNLYPDVAKNVVQSKMMRENYSIQCRRALDNLPFKSISFVVEHCQVELPDLGLFENFIHG 217
13 -10.400IDP91360 16S rRNA uridine-516 pseudouridylate synthase [Vibrio vulnificus CMCP6] VV1_2843 [Vibrio vulnificus CMCP6]  ali follow..  14  1MRLDKFLCDALGA-TRKEATKILKSGEVTVNEQVQKSGAVKVTEECVVMLYKPEGFVCSHEDGFNHTAFVLLDEVKMDELHFAGTDDGKWSHRITKHKCDKTYRVWLADPIGSDYAEKLAEGVQLRNEKELTLPAENEVLLTIHEGKYHQVKRMFAALGNKVEQLHRERIGAIELDESLEPGEYRYLTQEEIDS......................................... 230
14 -10.300IDP00268 gene: N/A; NS5 methyl transferase and RNA polymerase AAX48017_2488-3387 [Dengue virus 4]  ali follow..  16  24.EFEEYKRSGILEVDRTEAKSALKDGSKI---------------------------VSRGSSKIRWIVERGMVKPKGKV-VDLGCGRGGWSYYMALKNVTEVKGYTKGEEPIPMATYGWNLVKLHSGVDVFYK-PTEQVDTLLCDIGESSLKMVEPWLSSKPEFCIKVLNPYMP--------------------TVIEELEKLQRKHGGSLVRCPLS----RNSTHEYWVSGVSG 226
15 -10.200IDP02332 UbiE/COQ5 family methlytransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA1462 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  16  8.................................................ANNKYTYAQRNAHISWGEMIKGITNIQNKQIIDIGCGGGIYTKELALMGAKSVVGLDFSKEILQAAKENCSGFISFIHGDAHSTPPNDTFDIVISRAVIHHLQDIPTFL----REASRILKK................................................................ 128
16 -10.100IDP95362 set237a-002 [Escherichia coli]  ali follow..  13  31........................................................TPPGAEYTIDYWIKHGCINKKSHLLDLACSTGFSSRECFKKEGASAEGIDISESAVMVANEKAKKLKANNLLK---YYVADACDLPFEDNTFGCNFAFIQNRLIALNETHRCLNH................................................................ 147
17 -10.100IDP92129 ftsJ-like methyltransferase domain-containing protein [Toxoplasma gondii ME49] TGME49_007990 [Toxoplasma gondii ME49]  ali follow..  17  18............................................DKFYHLAKEQGYRARSAFKLLQLSQRFRLFEKCASVVDLCAAPGGWLQVAAKH-ATTIVGVDLGVQTFTGDITTPQ------AAKLRKLVKFGEVDLVLHDGS-LCAAKLACQLLAAGATFVSKV---FR-------------ADYAALLYVLQTLFERVD---------ATKPQASRAVSAEIFVVCRG. 205
18 -10.000IDP90290 arginine N-methyltransferase 1 [Toxoplasma gondii ME49] TGME49_019520 [Toxoplasma gondii ME49]  ali follow..  20  94..............................................................CYQRAICQNAHLFANKVVLDVGSGTGILSLFAAKAGAKHVYGIECSE-KIVKENDMEDKVTFVQGKAEEVSLPVEKVDIIISE-YFLLYESMLDTVLFCRDKWLKMIFPD............................................................... 213
19 -10.000IDP95457 set236a-001 [Undefined organism]  ali follow..  11  50...........................................................................PIHSVIDIACGLNPLAHPWMPLAAATYDAYDIYQGMMTDYFALRNIRGTASACDVIQSCPTQEVDVALL-LEQLEKWAAHHLLHTLNARYLIVSYPIQSLGG----------KSKGMSTYYESHFRSLISDTPWTIKKLEFAN--------EMVFVVAK. 199
20 -10.000IDP95396 set236a-061 [Undefined organism]  ali follow..  11  114...........................................................................RPRCILDLACGLNPVYLSVRLPEDCRIVGVDIQGECVH---ILNEAIGSPERIIGIHADLLSRDAIPSERFDVALMFKILPLLAAVNARYLVISYPTRTLGG----------RDVGMMENYAAWMADHMPDNRIVVDQFVAGN--------ELFYILKEN 264
21 -9.840IDP95361 set237a-001 [Yersinia pseudotuberculosis PB1/+]  ali follow..  11  32...........................................................GGMFTLDYWIEKSRINSNTYLLDLACSTGFSARNIVHKTGCSAEGIDISARSIESANQLAVQGNIAECVH---FSVGNAESVSFTDNTFGCCFGFISDKPAALVEVQRVLKQ................................................................ 145
22 -9.840IDP95435 set236a-037 [Undefined organism]  ali follow..  12  27...........................................................................PVRSVLDLACGLNPLALPWMPLADARYYACDIYADMIASFFAQAGIRGQARVCDLVAGAPDEQVDLA---LVLKALPPLDQQAKHAGRDLLRALNARHILVSFPAHSLGG--RGKGMAENYEQRFRALADAEGWSIERFVFR--------TELAFLIRK. 176
23 -9.710IDP95425 set236a-027 [Undefined organism]  ali follow..  12  2.............................................................................RSVLDLACGLNPLALPWMPLAPDRYYACDIYADMIASFFAQSGIRGQARVCDLVAGAPDEQVDLALV-LEQQAKHAGRDLLRALNARHILVSFPAHSLGG----------RGKGMAENYEQRFRALADAEGWSIERFVFPT--------ELAFLIRK. 149
24 -9.590IDP02273 hypothetical protein GBAA3714 [Bacillus anthracis str. `Ames Ancestor`] GBAA3714 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  14  1.......MKKRKDIHFRIEEKLLERFESALHYEGLKKTDVLTHAIQQFCMKVEYEKMNDVKRQYEIVIEHLQLQ-GRERILEVGCANGKFLSLLQANGHKQLTGFDQSEAMLSEATKTNNLIEWRLG-DAGKLPEANYYDLIVARHMLYHMKDVEKTI----QGFHKVIHP................................................................ 184
25 -9.590IDP91276 ribosomal protein L11 methyltransferase [Bacillus anthracis str. Sterne] NT05BA4392 [Bacillus anthracis str. Sterne]  ali follow..  15  121...........................VQISDTFTIVPTTPSSPEEKIIELDPGMAFGTGTHPTTTMCIRAKTVQPGDTIIDVGTGSGVLSIAAAKLGASSVQAYDL-----------DPVAVESAEMNVRLNKTDDVVSVGQNSLLEGIEGPVDLIVANLLAEIILLFPEDA----ARVVKSGGLFITSGIIAAKEKVISEALEKAGFTIEEVLRM.................. 301
26 -9.570IDP90289 arginine methyltransferase protein, putative [Toxoplasma gondii ME49] TGME49_094270 [Toxoplasma gondii ME49]  ali follow..  28  235..............................................................TYQRAIVENRADFEGKTVMDVGAGSGILSFFAAQAGAKKVYAVEKGNPSLGSRI----QIINKPLESIEDSEVPEKVDVLISEPIGTLLERMIETYLSARDRFLKKMFPS............................................................... 357
27 -9.500IDP06158 hypothetical protein jhp0682 [Helicobacter pylori J99] NP_223400 [Helicobacter pylori J99]  ali follow..  16  12KRIDEFLAKE-LQISKNQVLNLIKEGLVFCQKKEVKKGGLALKEGDAITLLVPKPLKKELDLEIEVIFEDEDLLVLNKPP--PSVKEPTLVDWLKSQNYELSNLGLKERYGIVHRLDKDTSGIVIAKNNFTHVCLSEQLKTKMMGRYYIAL.................................................................................... 171
28 -9.410IDP95434 set236a-036 [Undefined organism]  ali follow..  13  118...........................................................................PVRSVLDLACGLNPLALAWMPLAAVRYYACDIYADMIAGFFAQAGIRGQARVCDLVAGAPDEQVDLALV-LDQQAKHAGRDLLRALNAQHILVSFPAHSLGG----------RGKGMTENYEQRFRALADAEGWSIERFIFP--------TELAFLVRK. 267
29 -9.370IDP95458 set236a-002 [Undefined organism]  ali follow..  15  98...........................................................................APHSVLDLACGLNALTLPWFPHEAITYYACDIYRPMIDATMEIMHIRGCAEVRDILQSCPTQEADLALV-LEQIDKQAGTRLLRAINARYMIVSFPAQSLGG----------RNKGMVTNYEARFYQLVEGENWEIQKYEFA--------TELVFVIKK. 247
30 -9.370IDP91436 gene: rluD; 23S rRNA pseudouridine synthase D [Vibrio vulnificus CMCP6] VV1_0484 [Vibrio vulnificus CMCP6]  ali follow..  18  18QRLDQAIAELFADFSRSRLKEWLLDGKVTVDGNVVTKPRTKVMGGEVITVLEDEVRWEAQDIPLDIVYEDDDILVINKPR--AGTPDGTVLNALLFHCPEVAEVPRAG---IVHRLDKDTTLMVVAKTVPAQTRLVRALQKRNITREYEAI.................................................................................... 174
31 -9.290IDP95415 set236a-017 [Undefined organism]  ali follow..  12  27...........................................................................PVRSVLDLACGLNPLALPWMPLAPDRYYACDIYADMIASFFAQAGIRGQARVCDLVASAPDEQVDLALV-LDQQAKHAGRNLLRALNARHILVSFPAHSLGG----------RGKGMAENYEQRFRALADAEGWSIERFVFPT--------ELAFLVRK. 176
32 -9.250IDP95407 set236a-009 [Undefined organism]  ali follow..  11  8VKNKLHQVAGAYVEGGDSGSRPYERWLGELREAAGSGDGESLKGGCRRIMGSHASTRERLPILEEFYGRIFEELPPVRSVVDVACGLNPLAIPWMGLDGTGYVAYDIYEDMMGGVLGIFGVEGRGETRDVVAEPSVEEVDLALV-LEQIDRSAGRRLLDGLKAKNMVVSFPVASLGG----------RNKGMAANYEARFWELAEGQDWVVKKLVFRS--------ELVFVVARE 233
33 -9.160IDP91784 gene: ermA; rRNA methylase Erm(A) [Staphylococcus aureus subsp. aureus N315] SA1480 [Staphylococcus aureus subsp. aureus N315]  ali follow..  10  19...............................................................VKEILNHTNISKQDNV-IEIGSGKGHFTKELVKM-SRSVTAIEIDGGVTKEAVNPSENIKVIQTDILKFSFPKHINYKIYGNIPYNISTDIVKRITFESQAKYSYLIVEKGFAKRLQNLQRAL................................................. 142
34 -9.160IDP91589 gene: ermA; rRNA methylase [Staphylococcus aureus subsp. aureus N315] BAB41266 [Staphylococcus aureus subsp. aureus N315]  ali follow..  10  19...............................................................VKEILNHTNISKQDNV-IEIGSGKGHFTKELVKM-SRSVTAIEIDGGVTKEAVNPSENIKVIQTDILKFSFPKHINYKIYGNIPYNISTDIVKRITFESQAKYSYLIVEKGFAKRLQNLQRAL................................................. 142

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35