current user: public

If you have questions about the server, please let us know.

Query: IDP06072 hypothetical protein jhp0418 [Helicobacter pylori J99] NP_223136 [Helicobacter pylori J99], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MEIILLIVAAVVLFYFYNTLKEYLKNPLNPKTKTEEYDLKNDPYLLVQSSPLDKFKQTQIGAYMRLLKFLDIQKNALDNALRTLFIHELEQPLNSEQQNLAKELLNEPVDKKENFESLCQEIADHTHGEYTKRLKLVEFLMLLAYADGILDSKEKELFLDVGAFLQIDNQDFNELYDNFEHFNSIEIPMSLEEAKNLFEIQTHTTMQDLEKKALDLSAPYYHKMNDNKRYSEQDFISLKKIALASQLLENDLKDSLast
1 -79.800IDP06072 hypothetical protein jhp0418 [Helicobacter pylori J99] NP_223136 [Helicobacter pylori J99]  ali  100  1MEIILLIVAAVVLFYFYNTLKEYLKNPLNPKTKTEEYDLKNDPYLLVQSSPLDKFKQTQIGAYMRLLKFLDIQKNALDNALRTLFIHELEQPLNSEQQNLAKELLNEPVDKKENFESLCQEIADHTHGEYTKRLKLVEFLMLLAYADGILDSKEKELFLDVGAFLQIDNQDFNELYDNFEHFNSIEIPMSLEEAKNLFEIQTHTTMQDLEKKALDLSAPYYHKMNDNKRYSEQDFISLKKIALASQLLENDLKDS 255
2 -24.000IDP01609 gene: dnaJ1; heat shock protein, hsp40 [Francisella tularensis subsp. tularensis SCHU S4] FTT1512c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  19  1..............................................................................................................................................................................................MADYYSLLGVSRDASEADIKKAYRRLAKKYHPDVNKEK----GAEDKFKEIQTAYDVLGDKEKKK 61
3 -22.200IDP91676 DNJA3_HUMAN [Homo sapiens]  ali follow..  13  80...................................................................................................................................................................................TASFHTSAPLAKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDD---PKAKEKFSQLAEAYEVLSDEVKRK 152
4 -22.000IDP02168 gene: dnaJ; chaperone protein dnaJ [Coxiella burnetii RSA 493] CBU_1289 [Coxiella burnetii RSA 493]  ali follow..  15  1............................................................................................................................................................................................MAKRDYYEVLGVNLNATEAEVKKAFRRLAMKYHPDRNPGD---KDAEVKFKEAREAYEVLCDSRKRA 64
5 -21.900IDP01404 dnaJ protein VC0856 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  1............................................................................................................................................................................................MSKRDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSGD---AGAAEKFKEVKEAYEILTDAQKKA 64
6 -21.800IDP00478 gene: dnaJ; chaperone protein DnaJ YPO0469 [Yersinia pestis CO92]  ali follow..  10  1............................................................................................................................................................................................MAKRDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSED---KNAEEKFKEAKEAYEILTDAQKRA 64
7 -21.700IDP01653 gene: dnaJ; chaperone protein dnaJ [Bacillus anthracis str. `Ames Ancestor`] GBAA4538 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  17  1............................................................................................................................................................................................MSKRDYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSKE----ENAIEKFKEVQEAYEVLSDDQKRA 63
8 -18.200IDP02811 gene: yebE; putative inner membrane protein [Salmonella typhimurium LT2] STM1880 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  93...............................................SQSTPLDVRTERLILALVFAAKSDGHIDAKERAAIEHQLRES--GVEEQGRVFIEKAIEQPL----DPQRLAQGIRN--------EEEALEIYFLSCAAIDIDHFMERSYLNALGDALKIPQEVRDGIEQDLQQQKQA...................................................................... 216
9 -13.600IDP01304 gene: hscB; co-chaperone HscB VC0751 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  2................................................................................................................................................................................................NYFELFGLPIELDGSLLSSQFRALQKRFHPDNFATASERDRAVQQAAQINDAYQTLKDPLRRA 68
10 -6.270IDP02058 gene: cpxP; periplasmic stress adaptor protein CpxP [Yersinia pestis CO92] YPO0075 [Yersinia pestis CO92]  ali follow..  12  48.............................................................................................................................................................HHNMFDGINLTEQQRQQMRDLMRQSHQSRLDLEDREAMHKLITADKFDEAAVRAQAEKMSQNQ----------IERHVEMAKVRNQMYNLLTPEQKEA 137

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35