current user: public

If you have questions about the server, please let us know.

Query: IDP06281 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [Streptococcus pneumoniae TIGR4] NP_345317 [Streptococcus pneumoniae TIGR4], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MTQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAAGFRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVDGFHPLNMGRLWSGHPVMIPSTPAGIMEMFHEYGIDLEGKNAVVIGRSNIVGKPMAQLLLAKNATVTLTHSRTHNLSKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDENGKLCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRKLast
1 -115.000IDP06281 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [Streptococcus pneumoniae TIGR4] NP_345317 [Streptococcus pneumoniae TIGR4]  ali  100  1MTQIIDGKALAAKLQGQLAEKTAKLKEETGLVPGLVVILVGDNPASQVYVRNKERSALAAGFRSEVVRVPETITQEELLDLIAKYNQDPAWHGILVQLPLPKHIDEEAVLLAIDPEKDVDGFHPLNMGRLWSGHPVMIPSTPAGIMEMFHEYGIDLEGKNAVVIGRSNIVGKPMAQLLLAKNATVTLTHSRTHNLSKVAAKADILVVAIGRAKFVTADFVKPGAVVIDVGMNRDENGKLCGDVDYEAVAPLASHITPVPGGVGPMTITMLMEQTYQAALRTLDRK 285
2 -113.000IDP01638 gene: folD; folD bifunctional protein [Coxiella burnetii RSA 493] CBU_0312 [Coxiella burnetii RSA 493]  ali follow..  48  2IARILDGRTCAEKVKARVKENIRLLQEKGLPSPGLAVILVGNDPASATYVAHKERACQAVGIRSTVYRMPNTITESELASKIDECNRDSNTHGILLQLPLPAHIDPANLLERIRPDKDVDGFHPYNLGRLVQRRPALRPCTPYGVMTLLTETHENLEGKHAVIVGASNIVGRPMALELLLAKCTVTVCHRFTRDLAEHVKSAELLIVAIGKPGIIQSEWIKPGAIVIDVGFSRLSPNKIAGDIDFETAKERASWITPVPGGVGPMTVATLLENTLQAAQTFL... 283
3 -111.000IDP02528 gene: folD; methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase [Bacillus anthracis str. `Ames Ancestor`] GBAA4405 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  55  2VAVIIKGNEVAEKKRAQLKEEVVKLKEQ-GIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIYSELIEFPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFHPISVGRMMTGQDTFLPCTPHGIVELVKETNLDISGKHVVVIGRSNIVGKPVGQLFLNENATVTYCHSKTQNMKELTKLADILIVAVGRPKMVTADYIKEGAVVIDVGVNRLETGKLCGDVDFDNVLDVASYITPVPKGVGPMTITMLLHNTVESAKRAGVVC 285
4 -110.000IDP90810 gene: folD; folD bifunctional protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0855 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  51  2..TLLDGKALSAKIKEELKEKNQFLKSK-GIESCLAVILVGDNPASQTYVKSKAKACEECGIKSLVYHLNENITQNELLALINTLNHDDSVHGILVQLPLPDHICKDLILESIISSKDVDGFHPINVGYLNLGESGFLPCTPLGVMKLLKAYEIDLEGKDAVIIGASNIVGRPMATMLLNAGATVSVCHIKTKDLSLYTRQADLIIVAAGCVNLLRSDMVKEGVIVVDVGINRLESGKIVGDVDFEEVSKKSSYITPVPGGVGPMTIAMLLENTVKSAKNRLN.. 282
5 -109.000IDP01849 gene: folD; methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase putative bifunctional protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0892 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  51  2..ILIDGKSLSKDLKERLATQVQEYKHHTAITPKLVAIIVGNDPASKTYVASKEKACAQVGIDSQVITLPEHTTESELLELIDQLNNDSSVHAILVQLPLPAHINKNNVIYSIKPEKDVDGFHPTNVGRLQLRKKCLESCTPKGIMTMLREYGIKTEGAYAVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITADMVKEGAVVIDVGINHV-DGKIVGDVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNR.. 282
6 -10.100IDP91167 gene: aroE; shikimate 5-dehydrogenase STM3401 [Salmonella enterica subsp. enterica serovar Typhimurium]  ali follow..  14  6......................................VFGNPIAHSKSPFIHQQFAQQLDIVHPYGRV--LAPINNFINTLDAFFA-AGGKGANITVPFKEEAFADELTERASLAGAVNTLKRLEDGRLLGDNT-----DGIGLLGDLERLNFIRPGLRILLIGAGG-ASRGVLLPLLSLDCAVTITNRTASRAEALAKEFDLIINATGEIPAIPASLIHPSLCCYDMFYQKGNTPFL--------SWCVQQGAKRYADGLG-----MLVGQAAHAVLLWHGVL 256
7 -10.100IDP04636 gene: aroE1; shikimate 5-dehydrogenase [Francisella tularensis subsp. tularensis SCHU S4] FTT0238 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  7......................................VIGFPVKHSLSPAIQMRLAQQYNQDMLFTAI--EVAPQDLEAKIQEFKTNPQVKGLSVTVPHKERVYADDADTTAKAVQAASNVIFTAERKMIALNYDGL------VNDIKNNYKIDFAGKKVLVVGAGGAAKAVVAAVLKESPLSLSITNRTLADFDNISDSFDIVINSTGKLLPLKDSNFNKNAFAYDL---------MYADGGTIFTKWCQAHNIAAADGKG-----MLKELSIAVFK...... 252
8 -9.520IDP90792 gene: aroE; shikimate 5-dehydrogenase [Vibrio cholerae O1 biovar eltor str. N16961] VC0056 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  10......................................VFGNPINHSKSPFIHTLFARQTQQSMIYTAQ--CVPVDGFTEAAKHFFA-QGGRGCNVTVPFKEEAYRDRLTERARLAGAVNTLKKLDDGEILGDNT-----DGEGLVQDLLAQQVLLKGATILLIGAGGAARGVLKPLLDQQPASITVTNRKAQAFEQLKQSYDVIINSTGELPAIDPVIFSSRSVCYDMMYGKGYTVFN---------WARQHGCAQAIDGLG-----MLVGQAAESFMLWRGLR 260
9 -9.400IDP04232 gene: aroE; shikimate 5-dehydrogenase [Clostridium perfringens ATCC 13124] CPF_0693 [Clostridium perfringens ATCC 13124]  ali follow..  13  6......................................LIGEKLGHSLSPEIHNKVFKDNNIDGLYNLF--SVKKDFENNIVESLKC--GVKGANVTIPYKEKV---DQLDIISHEAKAIG--AVNTILIKDGKSYGYNTDYYGFGKMLERAKVNIEGNSFFVLGAGGAARSILKYLEDSKAKKIVLVSRDREKAFKKFKDFNINFMSYGELEEINEEFALINTTPCGVSEKVIKKFKVAVDIVYNPLETKFLKMAKDNGLKTVDGLFMLVGQGVKAEEIWNGIK 254
10 -8.930IDP90166 gene: aroE; shikimate dehydrogenase [Clostridium difficile 630] CD1837 [Peptoclostridium difficile 630]  ali follow..  18  6......................................LVGEKLSHSVSPQIHKRVFEILNIESAYKNF--EISKEDISKLDGAIKL--GIQGVNVTVPYKERI---KYLDFISPEAKRIG--AVNTILLRENMLYGYNTDYFGLDSMFKMANIDVQGKVAVILGTGGASKAALTYFIDSGIEKLYVSTRKKDDKKLLNSKGDIILTPVGMISPVSKSIIQNFDILIDL---------IYNPGETEFLRIGNSMGKKTCDGLY-----MLVGQAIKSQEIWQDTK 251

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35