current user: public

If you have questions about the server, please let us know.

Query: IDP06283 gene: gmk; guanylate kinase [Streptococcus pneumoniae TIGR4] NP_346174 [Streptococcus pneumoniae TIGR4], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MADRGLLIVFSGPSGVGKGTVRREIFESSENQFQYSVSMTTRAQRPGEVDGVDYFFRTREEFEELIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDAVFIFLTPPDLDELQDRLVGRGTDSAEVIAQRIEKAKEEIALMREYDYAIVNDQVPLAAERVKCVIEAEHFCVDRVIGHYQEMLPKSPTTRLast
1 -102.000IDP06283 gene: gmk; guanylate kinase [Streptococcus pneumoniae TIGR4] NP_346174 [Streptococcus pneumoniae TIGR4]  ali  100  1MADRGLLIVFSGPSGVGKGTVRREIFESSENQFQYSVSMTTRAQRPGEVDGVDYFFRTREEFEELIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDAVFIFLTPPDLDELQDRLVGRGTDSAEVIAQRIEKAKEEIALMREYDYAIVNDQVPLAAERVKCVIEAEHFCVDRVIGHYQEMLPKSPTTR 208
2 -100.000IDP01611 gene: gmk; hypothetical protein lmo1827 [Listeria monocytogenes EGD-e] lmo1827 [Listeria monocytogenes EGD-e]  ali follow..  61  1MTERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQDGVDYYFRSREVFEQAIKDGKMLEYAEYVGNYYGTPLEYVEEKLAAGVDIFLEIEVQGAMQVRKAMPEGIFIFLTPPDLSELKNRIIGRGTESMEVVEERMETAKKEIEMMASYDYAVVNDVVANAVQKIKGIVETEHLKTERVIHRYKKMLEGL.... 204
3 -98.500IDP02139 gene: gmk; guanylate kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA4009 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  61  3.SRRGLLIVLSGPSGVGKGTVRKELFSHEDTRFQYSISVTTRKPREGEVDGVDYFFKEREEFEEMIRNEKLLEWAEFVGNYYGTPIDYVEKTLQEGKDVFLEIEVQGAIQVKKAFPEGVFIFLAPPSLSELKNRIVGRGTETEDVIENRLTVAKEEIDMMDAYDYVVENDQVELACERIKAIVVGEHCRRERVAKYYKEMTEGL.... 205
4 -96.300IDP06121 gene: gmk; guanylate kinase [Helicobacter pylori J99] NP_223024 [Helicobacter pylori J99]  ali follow..  33  1MNNDFNLLILSGPSGAGKSTLTKYLQEKIPK-THFSLSTTTRKPREGEVDGLHYNFVSEEEFKQGIEKGQFLEWAIVHNHYYGTSKIPVEKALKEGKIVIFDIDVQGHEILKKHYPNACSVFISTKNQEILKERLLLRGTDSKETIEKRLINAYKEMQCLESFDYLIINEDLEKSKEIILSIAKTLVHRLKAFN--FEKICKAWKNES 205
5 -96.100IDP90623 gene: gmk; guanylate kinase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1177c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  36  1MKLQGFVLLISGPSGAGKSTLLKKLFDEFEDELYFSISSTTRKPREGEKNGIHYHFISHEEFQKGIDSDHFLEWARVHENFYGTSLKHTQNALDNGKIVVFDIDVQGFKIARKKMADIVSVFITTKNKDELKKRLIKRNTDTIIQLEKRLQNASDEMKELSEYDYLIINDELKQSYEALRAILIAHKFRTKGQN.............. 195
6 -95.300IDP90539 gene: gmk; guanylate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC2708 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  45  23.MGKGTLYIVSAPSGAGKSSLIAALLEQNPTAMKVSVSHTTRGMRPGEQDGVHYHFVEKEHFIELIGKGEFLEYAEVFGNYYGTSRVWIENTLNKGIDVFLDIDWQGARQIRSQMPEAKSIFILPPSKEELERRLNTRGQDSDAVIAKRMGEAKSEISHYSEYDYVIINDDFDVALMDFKAIIRAERLKQDKQAAKYSAMLSALLAE. 229
7 -79.900IDP92045 guanylate kinase, putative [Toxoplasma gondii ME49] TGME49_042730 [Toxoplasma gondii ME49]  ali follow..  35  102.DTAPRILVVAGPSGVGKGTLVKRIFAKWPQAFGFSISHTSRQPRPGETHGKEYFFCSREEFEKLKKEGHFVESAEFSGNCYGTSFAAVDNVRRGERICLLEIDMAGVLQIQSTAQEANFVFIQPPSIEELKARLRGRRTENEEHIAKRLAAAQRELALAKEFDFYLTNDNLEDAWQKLEAQLVQWYGPVFKKAAGPGEKRSRLSEEE 312
8 -13.000IDP05086 deoxynucleoside kinase family protein [Bacillus anthracis str. Ames] BA_0014 [Bacillus anthracis str. Ames]  ali follow..  12  8DIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTRWSFHLQVYFRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPKEMHGRYENRLNINEYDILKDGDSIEPIIKKIGHFLKQTR..................... 218
9 -12.800IDP01671 gene: cysA; sulfate/thiosulfate transporter subunit [Yersinia pestis CO92] YPO3012 [Yersinia pestis CO92]  ali follow..  13  26..PSGQMVALLGPSGSGKTTLLRIIAGENQNAGRLSFHGTDVSRLHARDRRVGFVFQHYALFRHMTVFDNIAFGLTVLPRRERPNAAAIKQKVGQLLEMVFPSQLSGGQKQRVALARAL---AVEPQILLLDEPFGALDAQVRKELRRWLRQLHEELK----FTSVFVTHDQEEAMEVADRVVVVSQGNIEQ................ 217
10 -12.600IDP02096 gene: prk; phosphoribulokinase 1 [Yersinia pestis CO92] YPO0178 [Yersinia pestis CO92]  ali follow..  17  1MSTKHPVIAVTGSSGAGTTTTSLAFRKIFQQLAQIEGDSFHRYTRPEMDAHISYFGPEANDFGQLEQSAEYSKHGTGRSRKYLPGTFTPWEPLPEPTDVLF---YEGLHGGVVTEHHDVLVGVVPIVNLEWIQKLVRRGHSREAVMDRSMDDYINYITPQFSRTHINFQ....................................... 206
11 -12.600IDP05129 gene: adk; adenylate kinase [Clostridium difficile 630] CD0091 [Peptoclostridium difficile 630]  ali follow..  18  1MEMDNMRIILLGPPGAGKGTQAVGIVEKYNDIFRKNIKEGTELGKKAKEYMDQGLLVPDELTVGLVTDRISQEDCKNGFMLDGFPRDIFLKNAGISLDKVVNIEVDKSILVSRAVGRRIHVEFNPPKVEGV-GELYQRADDNEETVSKRIQVYLDETKPLVDY--IKGDQAIDKVFEDIVAALGSGK..................... 221
12 -12.600IDP01125 ABC transporter, ATP-binding protein BA_5175 [Bacillus anthracis str. Ames]  ali follow..  13  21..QKEKITCIIGESGSGKSTLLRML-------------NDLQSPTSGIINGKLISDYPPIQLRRMLGQTPPIFDGTIKDNLMGLRLSEKPFPNDDILRSALKTSLSGGEKQRLAFARIV---LMDPPVYLLDEPTSALDSDTERRVMKQFTTLAREKKKT----VIFITHSQQLPEEIADDIIEISKANGATRKEVLSV......... 215
13 -12.400IDP01891 gene: prkB; putative phosphoribulokinase [Salmonella typhimurium LT2] STM3464 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  1MSAKHPVIAVTGSSGAGTTTTSLAFRKEGDSFHRYTRPEMDMAIRKARDAGRHISYFGPEANDFSLLEHTFIEYGQGQSRKYLPGTFTPWQPLPEPTDVLF---YEGLHGGVVTPQHDVLVGVVPIVNLEWIQKLIRRGHSREAVMDRSMDDYINYITPQFSRTHINFQ....................................... 206
14 -12.400IDP01471 phosphoribulokinase VC2613 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  1MSAKHPIIAVTGSSGAGTTTTSEAFRKEGDSFHRFTRPEMDVEIRKAREQGRHISYFGPQANDFPTLEEFFRQYGKGQVRRY-PGTFTPWQSLPENSDVLF---YEGLHGGVVDGDVNVLIGMVPIVNLEWIQKYVRRGHSREAVMDRSMDDYLKFITPQFSRTHINFQ....................................... 206
15 -12.300IDP00988 gene: yehX; putative ABC-type proline/glycine betaine transport system ATPase component STM2163 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  25..SEGSFSVLIGTSGSGKSTTLKMIVEHDSGTIRFAGEEIRSLPVLELRRRMGYAIQSIGLFPHW----TVAQNIATVPQLQKWSRARINDRIDELMALLYPHQLSGGQQQRVGVARAL---AADPQVLLMDEPFGALDPVTRGALQQEMTRIHQLLGRT----IVLVTHDIDEALRLADHLVLMDGGHVIQ................ 215
16 -12.100IDP92081 thymidylate kinase, putative [Toxoplasma gondii ME49] TGME49_106970 [Toxoplasma gondii ME49]  ali follow..  14  6.PKRGCLVVFEGIDRSGKSTQARLAYERLTKE-----AELIRFPDRTTPIGQVLDRFLANASWSSDGQHPQVPPPQLTHLLFAANRARILRALGEGRTVLVDIAYTVGAERGLLAPDAVFFLDVAPQETQKRGGYGDEVYEKLA-TQERVYQVYRQFDNLPYWRRIASSLSIEELHEKLFEQLKS....................... 245
17 -12.000IDP02381 gene: proV-1; glycine betaine/L-proline ABC transporter, ATP-binding protein [Bacillus anthracis str. `Ames Ancestor`] GBAA2279 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  26..KKGEFFVLIGPSGCGKTTTMKMIIETTEGSILIDGKDIQQYNINELRWDIGYVLQQIALFPHM----TIAENIAVVPEMRKWSKEKIKARVDELLQMV---ELSGGQKQRIGVVRALAIVLMDEPFSALDPLSREQLQKDIVQLQKKIQKT-----------IVFVTHDMQEALSLGDRICIMKEGKVVQ................ 217
18 -11.900IDP02039 putative ABC transport ATP-binding subunit [Yersinia pestis CO92] YPO1198 [Yersinia pestis CO92]  ali follow..  12  25..SKGEFTVLIGTSGSGKSTTLKMIIEHDEGKIRFAGEEIRNYKPEDLRRRMGYAIQSIGLFPHW----TVERNIATVPQLLKWPKDRIRQRVVELLELLYPHQLSGGQQQRVGVARAL---AVDPEVLLMDEPFGALDPVTRSALQLEITRIHQLSGRT----IVLVTHDIDEALSLADRIVLMDEGRVIQ................ 216
19 -11.800IDP90611 gene: tmk; thymidylate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC2016 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  2...NAKFIVIEGLEGAGKSTAIQVVVETLQQNGIDHITRTREPGGTLLAEKLRALVKEEHPGEELQDITELLLVYAARVQLV---ENVIKPALARGEWVVGDQAYQGGGRLGDFKPDLTLYLDIDPKLGLERARGRGRIEKMDISFFERARERYLELANSDDSVVMIAAQSIEQVTADIRRALQDWLSQVNR................ 211
20 -11.500IDP00731 ABC transporter, ATP-binding protein SACOL2462 [Staphylococcus aureus subsp. aureus COL]  ali follow..  14  26..DKGESIAIIGPSGSGKSTFQKQI-------------CNLFSPTSGELKGKPYNDYDPEELRQRIQQSDLFGETIEDNMIFPSLARNDKFDRKRAKQLIKDVNMSGGERQRIAIARQL---MYTPDILLLDESTSALDVNNKEKIENIIFKLADQ-----GVAIMWITHSDDQSMRHFQKRITIVDGQISN................ 212
21 -11.400IDP01763 gene: ssuB; aliphatic sulfonates transport ATP-binding subunit [Yersinia pestis CO92] YPO3627 [Yersinia pestis CO92]  ali follow..  16  36..TAGQFVAVVGRSGCGKSTLLRLLAGLEAASDGTLLSGNALLSHAKDETRLMF------------QEARLLPWKKVIDNVLGLRGHWRDEALQVLDTVGLA-ALSGGQKQRVALARAL---IHRPRLLLLDEPLGALDALTRIEMQGLIERLWQQHGFT----VLLVTHDVSEAIALADRVLLIEEGRIGL................ 214
22 -11.400IDP01336 gene: potA; putrescine/spermidine ABC transporter ATPase protein VC1428 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  41..NHGEFLTILGPSGCGKTTVLRMIAGETADQGQILLDDQDVTQVPAEQRHVNTVFQSYALFPHM----TVFENVAFGLRMQKVPQSEIEPRVMEALRMV---QLSGGQQQRIAIARAV---VNKPKVLLLDESLSALDYKLRKQMQSELKQLQRQLG----ITFIFVTHDQEEALSMSDRIIVMRSGKIEQ................ 228
23 -11.400IDP00730 amino acid ABC transporter, ATP-binding protein SACOL2453 [Staphylococcus aureus subsp. aureus COL]  ali follow..  14  26..QSGEFIAFIGTSGSGKTTALRMIIEATEGQIEIDGKDVRSMNPVELRRNIGYVIQQIGLMPHM----TIKENIVLVPKLLKWTKEEKDKRAKELIKLVYPAELSGGQQQRIGVVRAL---AAEQDIILMDEPFGALDPITRDTLQDLVKTLQRKLGKT----FIFVTHDMDEAIKLADKICIMSEGKVVQ................ 216
24 -11.400IDP06247 gene: adk; adenylate kinase [Streptococcus pneumoniae TIGR4] NP_344771 [Streptococcus pneumoniae TIGR4]  ali follow..  15  3.......LLIMGLPGAGKGTQAAKIVEQFHDMFRAAMANQTEMGVLAKSYIDKGELVPDEVTNGIVKERLSQDDIKETGFLLGYPRDKTLAELGIELEGVINIEVNPDSLLERLS-GETFHKVFNPPVDYKEEDYYQREDDKPETVKRRLDVNIAQGEPIIAH--IEGNQDINDVFSDIEKVLTNLK..................... 212
25 -11.300IDP01464 ABC transporter, ATP-binding protein VC2520 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  30..PKGKVTAIMGPSGIGKTTLLRLIGG-------------QLLPEQGEIDGENIPTLSRRKLYRLFQSGALFTDLNVFDNV-ELDEAMIKTLVLLKLEAVMPSELSGGMARRAALARAI---ALDPELIMYDEPFVGQDPITMGVLVELIRNLNRALG----VTSVVVSHDVPEVMSIADWVYLLADGKV.................. 221
26 -11.300IDP01490 ABC transporter, ATP-binding protein VCA0602 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  58..EKGEFVCFLGPSGCGKTTLLRAIAGDLPTSGTIHQNQQAITFLPPEQRDFGIVFQSYALFPNL----TVEENIAIGLRNQGMSVRDALEKVEQWLEMI---QLSGGQQQRVALARAL---ALSPGLLLLDEPLSALDAKVRTHLREEICQLQRKLG----ITTIMVTHDQEEALTMADRIVVMNHGVIEQ................ 245
27 -11.300IDP01902 gene: potG; putrescine transporter ATP-binding subunit [Salmonella typhimurium LT2] STM0878 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  43..YKGEIFALLGASGCGKSTLLRMLAGEPPSSGQIMLDGVDLAHVPPYQRPINMMFQSYALFPHM----TVEQNIAFGLKQDKLPKAEITSRVNEMLGLV---QLSGGQRQRVALARSL---AKRPKLLLLDEPMGALDKKLRDRMQLEVVDILERVG----VTCVMVTHDQEEAMTMAGRIAIMNRGKFVQ................ 230
28 -11.300IDP01341 gene: fbpC; ferric transporter ATP-binding subunit VCA0687 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  30..KKGSLVTLLGPSGCGKTTVLRLVAGEKPTSGQIFIDGEDVTERSIQQRDICMVFQSYALFPHM----SLYENVAYGLKMLKLPSEEVRQRVDEALKIV---QISGGQQQRVALARAL---VLKPKVLLFDEPLSNLDANLRRSMRETIRELQQRFD----ITSLYVTHDQAEAFAVSDTVIVMKQGDIMQ................ 217
29 -11.200IDP91820 gene: adk; adenylate kinase [Escherichia coli str. K-12 substr. MG1655] b0474 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  21  3.......IILLGAPGAGKGTQAQFIMEKYGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQKEAGINVDYVLEFDVPDELIVDRIVGRRVHVKFNPPKVEGK-EELTTRKDDQEETVRKRLVEYHQMTAPLIGY............................................. 181
30 -11.200IDP00713 spermidine/putrescine ABC transporter, ATP-binding protein SACOL1108 [Staphylococcus aureus subsp. aureus COL]  ali follow..  12  28..ESGYFYTLLGPSGCGKTTILKLIAGEYPDSGEVIYQNKPIGNLPPNKRKVNTVFQDYALFPHL----NVYDNIAFGLKLKKLSKTEIDQKVTEALKLV---EMSGGQKQRVAIARAI---VNEPEILLLDESLSALDLKLRTEMQYELRELQSRLG----ITFIFVTHDQEEALALSDFLFVLKDGKIQQ................ 215
31 -11.200IDP02608 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0178 [Coxiella burnetii RSA 493]  ali follow..  12  27..KDGETLVLLGSSGSGKTTLMKRLIEPTSGTIKIEGKDVREYNLSELRRSIGYVFQQIGLFPHM----TIEKNITILLKLLHYPKAKRIQRAAELLEMVYSDELSGGQQQRVGVARALAYLLMDEPFGALDAMTRSALQEEMIHLNQKLGKT-----------IVFVTHDIFEAFRIADRIAVMHKGKLEQ................ 218
32 -11.200IDP00480 gene: adk; adenylate kinase YPO3118 [Yersinia pestis CO92]  ali follow..  21  3.......IILLGAPGAGKGTQAQFIMEKYGDMLRAAVKAGSELGLKAKEIMDAGKLVTDELVIALVKERITQEDCRDGFLLDGFPRTIPQKEAGIKVDYVLEFDVPDELIVERIVGRRVHVKFNPPKVEDK-EELTIRKDDQEATVRKRLIEYHQQTAPLVSY............................................. 181
33 -11.200IDP01607 ABC transporter, ATP-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1608 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  27..PTNKITTILGPSGAGKTTILQLIAKPTLGKICIDNAIIEKNTKETQLEKL------RHRMGFLFQSGALFTHLSVYDNI-NLDEKLIRNIVLLKLQAVMPSELSGGMARRVALARSI---AMDPDIMMYDEPFTGQDPASFNKLLELISTLNESLN----MTSIIVSHDIQESLSISDHIIIVGNKKIIA................ 221
34 -11.100IDP04500 gene: adk; adenylate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC0986 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  19  3.......IILLGAPGAGKGTQAQFIMEKFGDMLRAAIKAGTELGKQAKAVIDAGQLVSDDIILGLIKERIAQADCEKGFLLDGFPRTIPQKEMGINVDYVIEFDVADDVIVERMAGRRAHVVYNPPKVEGK-EDLVIREDDKEETVRARLNVYHTQTAPLIEY............................................. 181
35 -11.100IDP92034 adenylate kinase, putative [Toxoplasma gondii ME49] TGME49_024900 [Toxoplasma gondii ME49]  ali follow..  15  32LAKPEGRYIFIGAPGSGKGTQSVKLKKSHCDMLRHAVATGTEYGKQAKAKLDAGELVSDEIVLGLIDEKLKTPECRRGFILDGFPRDNLLKQKNQKLDGVLYFDVPDNILVERVSGRRIHVTYHPPKVAGL-EPLHHRKDDNEATLKKRLDVFHKETVPVIEH--MDAAKDSTAVTKEMYDFVGKHHKSF.................. 255
36 -11.100IDP02287 gene: adk; adenylate kinase [Francisella tularensis subsp. tularensis SCHU S4] FTT1161 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  16  3.......IILLGAPGAGKGTQAKIIEQKYNDMIRETIKSGSALGQELKKVLDAGELVSDEFIIKIVKDRISKNDCNNGFLLDGVPRTIPQDKLGVNIDYIVEVDVADNLLIERITGRRIHTKFNPPKVADK-EPLITRTDDNEDTVKQRLSVYHAQTAKLIDF............................................. 181
37 -10.900IDP02339 gene: proV; glycine betaine/L-proline transport ATP-binding protein [Yersinia pestis CO92] YPO2647 [Yersinia pestis CO92]  ali follow..  16  52..EEGEIFVIMGLSGSGKSTLVRLL-------------NRLIEPTRGEVDGEDIAKISDSALRTVRRNKALMPHLNVLDNLAGIPLLERNEKALEALRQV---ELSGGMRQRVGLARAMAILLMDEAFSALDPLIRTEMQDELVKLQAKHQRT-----------IVFISHDLDEAMRIGDRIAIMQGGEVVQ................ 245
38 -10.800IDP02079 iron ABC transporter, ATP binding subunit [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0173c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  26..KEGEFLSILGGSGSGKSTLLRIIA---------KLEQASSYDLFSCKGEVALMFQNYALFPHLNVEKNILFALYDKKDKNQILNHLLKTFEIEDLRYKKIDEISGGQAQRVAFARAM---ARGCKLLLLDEPFSNLDQNLKQDLRRELKKMIENQG----ITAIMVTHDIEDAYCMSDQIAFLEKGKILA................ 199
39 -10.800IDP04119 adenylate kinase [Bacillus anthracis str. Sterne] BAS0131 [Bacillus anthracis str. Sterne]  ali follow..  17  3.......LILMGLPGAGKGTQAEQIVAKYNDMFRAAMKAETEMGLQAKSFIDKGALVPDEVTIGIVRERLSQEDCVRGFLLDGFPREEIMKDLGKKIDYVLNINVDSGLLLKRLTGRRIHLEFNAPAKADV-GELYQRSDDNEETVANRLDVNIKQTKPLLDF--INGEQDINKVFADIDVLIGG....................... 214
40 -10.700IDP01758 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0728 [Coxiella burnetii RSA 493]  ali follow..  16  34..HRGEIVAIIGPSGCGKTTLLRSILM-------------LRKPTAGTIFGINILECSRAEALSMFQSSALFSSLRVLENV--LHSEAQTKLALLKIALVYPAELSGGMKKRAALARAM---ALDPELLFLDEPTTGLDAKSARELNELILHLRKTLE----LTFVMVTHDLDTLWQVPDRVFFLGEGKVLA................ 228
41 -10.700IDP02015 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0107 [Coxiella burnetii RSA 493]  ali follow..  12  29..SAGEMFGVIGKSGAGKSTLIRCV-------------NLLERPDKGSVDGQVLTTLSSKVLRQVFQHFNLLSARTAYQNLLGKNPTEIRKVVLPLLELTYPSQLSGGQKQRVAIARAL---VTNPTVLLCDEMTSALDPETTHSILQLLKNINRELN----LSILLITHEMEVIKTVADRVAVLDQGRIVEE............... 222
42 -10.600IDP02457 ABC transporter, ATP-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1248 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  13  29..PFEKISCIIGASGCGKTTLMREILM-------------LQPIYSGKILGQEISKLADNPIKRMFQHCALFSSLTNLQNV-KLPIDILTDIAIIKLKMVYPSEISGGMLKRVALARTI---ALDPKVVFLDEPNAGLDPYSARAMDDLILYLKEELK----MSVVMITHDLSTIWHIVDDIIYMDEKRI.................. 223
43 -10.600IDP00325 gene: coaE; dephospho-CoA kinase Cj1530 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  10  3.....NAFFVTASIACGKSTFIEIANS-----LGFKSISADKIAHKILDENALELEKIFSPFKNLLKKEKKIDRKILGEIVFNNKEAQMQILDKENKAFFVEIPLFFESGAYENLGKVIVIYT---PKELSLKRIMQRDKLSLEAAKARLDSQIDIEEKLKKADFIIKNTSYADFRQECVKVIQE....................... 195
44 -10.500IDP00935 gene: modC; molybdate transporter ATP-binding protein STM0783 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  22..PASGITAIFGVSGAGKTSLINAISRPQKGRIALNHDAENGICLTPEKRRIGYVFQDARLFPHYKVRGNLR---------YGMAKSMTGQFDKLVSLLGIE-SLSGGEKQRVAIGRAL---LTAPELLLLDEPLASLDIPRKRELLPYLQRLAREIN----IPMLYVSHSLDEILHLADKVMVLEDGQVKA................ 209
45 -10.500IDP01155 Methionine import ATP-binding protein metN 2 BA_0312 [Bacillus anthracis str. Ames]  ali follow..  14  29..EKGEIFGIIGFSGAGKSTLLRLV-------------NMLERPTAGTIDDKDITSLSTKELRKIFQSFNLFNSRTVFGNLAKVPKNEIKERVNELLKFVYPEQLSGGQKQRVGIARAL---ATSPDILICDEATSALDPETTTEILNLLKKVNREYN----LTILLITHEMHVVKEICHRVAVMEKGKVIEE............... 222
46 -10.500IDP00916 gene: metN; DL-methionine transporter ATP-binding subunit STM0247 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  29..PAGQIYGVIGASGAGKSTLIRCV-------------NLLERPTEGSVGGQELTTLSESELTKIFQHFNLLSSRTVFGNLDNTPKEEIKRRVTELLDLVYPANLSGGQKQRVAIARAL---ASNPKVLLCDEATSALDPATTRSILELLKDINRRLG----LTILLITHEMDVVKRICDCVAVISNGELIEQ............... 222
47 -10.500IDP06310 gene: coaE; dephospho-CoA kinase [Streptococcus pneumoniae TIGR4] NP_345452 [Streptococcus pneumoniae TIGR4]  ali follow..  14  3.....KIIGITGGIASGKSTVTNFLRQ-----QGFQVVDADAVVHQLQKPGGRLFEALVQHFQEIILENGELNRPLLASLIFSNPDELREQLAQTEEIFFMDIPLLFEQDYSDWFAETWLVYV---DRDAQVERLMKRDQLSKDEAESRLAAQWPLEKKKDLASQVLDNNNQNQLLNQVHILLEG....................... 194
48 -10.400IDP90561 gene: cmk; cytidylate kinase [Yersinia pestis CO92] YPO1391 [Yersinia pestis CO92]  ali follow..  15  1MTAIAPVITVDGPSGAGKGTLCKALAESLSTEEALVPLAAHLDVRFVSQNGQLQVILEGEDVSNEIRTETVGNTASQAAAFPRVREALLQRAFREAPGLIAD----GRDMGTIVFPDAPVKIFLDASSQERAHRRMLQLQERGFNVN--FERLLAEIQERDNRDRNRSVAPLVPAADAL--VLDSTSMSIEQVIEQALAYAQRILALP 227
49 -10.300IDP00706 ABC transporter, ATP-binding protein SACOL0504 [Staphylococcus aureus subsp. aureus COL]  ali follow..  14  29..NRNDIFGVIGYSGAGKSTLVRLV-------------NHLEAASNGQVDGHDITNYSDKMMRDIFQHFNLLNSATVFKNLSKKSKTEIKQRVTEMLEFVFPDELSGGQKQRVAIARAL---VTNPKILLCDEATSALDPATTASILTLLKNVNQTFG----ITIMMITHEMRVIKDICNRVAVMEKGKVVET............... 222
50 -10.300IDP00333 gene: coaE; Dephospho-CoA kinase FTT1487 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  13  1MNFINTYPIITGGIASGKSTATRILKEK----LNLNVVCADTISREITKKPSVIKKI-AEKFGDEIVMNKQINRAMLRAIITESKNKEIKKQVKESDTVMTIVDIPLLGPYNFRHYDYLKVIVIKADLETRIRRLMERDGKNRQQAVAFINLQISDKEREKIADFVIDNTTNQELESKLITTINE....................... 198
51 -10.300IDP02375 gene: engB; GTPase EngB [Bacillus anthracis str. `Ames Ancestor`] GBAA4701 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  10  26.......IALAGRSNVGKSSFINKILNRK------KLVRISSKP--GKTQTLNFFLINEMMHFVDVPGYGYAKVSKTERAAWGKMIETYFTTREQLDAAVLVVDLRDVMMYDFLKHYDIPTIIIATKADKIPK----------GKWQKHLKVVKETLDIESGDEVVLFSSETGLGKEEAWKAIHK....................... 191
52 -10.200IDP01389 iron(III) ABC transporter, ATP-binding protein VC0610 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  28..NPGEIVCLLGASGCGKTTLLKAIAPLASGQLSLNCVTLDDGKRPPEQRNIGMIFQDYALFPHLTVAQNVG---------FGLDAMPAKQKEAKIAEMLALVQLSGGQQQRVAIARAL---AYKPDLLLLDEPFSNIDTQVRHELIIEIRKIFKQQG----VTAIFVTHSREEAFAFADKMAVMNRGVIEQ................ 217
53 -10.100IDP91389 Type II secretory pathway, component ExeA [Vibrio vulnificus CMCP6] VV1_1437 [Vibrio vulnificus CMCP6]  ali follow..  13  39LDMGEGIVKVTGEVGTGKTMVCRMLIDQLSDKVNLVYLPNPV--------------LSGHELQMAIAREMGLKTYD--VSLVPLIQDCLIGMRQRGMRTVLLVD---AQALPLEAMEALRLFIAQHELRQFRQRITFSIEEGVAFIDSRLAKA....................................................... 205
54 -10.100IDP01835 gene: coaE; dephospho-CoA kinase [Coxiella burnetii RSA 493] CBU_0152 [Coxiella burnetii RSA 493]  ali follow..  18  2.....LRIGLTGGIGSGKSTVANYFAE-----LGAPVIDADQIAHEITKPDQAAFKQIINHFNAVLTKGKFLNRTKLRELIFENPRQWLENLLIKAPYCILAIPLLAEASQSVDFIDRILVVDAPETLQI--QRTKSRDQLSDQQIQLILQSQSPREKRLAIADDVIVNDTIPILRKAVFQL.......................... 189
55 -10.100IDP02511 gene: sufC; ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_1359 [Coxiella burnetii RSA 493]  ali follow..  13  25..NAGEVHAIMGPNGSGKSTLASVLYAIVDGDVRYF-DLFELSPEDRAAKGLFLAFQYPVEIPGVNNLYFLKTAVNSIRKTRGEAPFDAIDLMGLVKEKLALVDMEGFSGGEKKRNEILQMLMLDPRLAILDETDSGLDIDALQTVAKGVNSLRNK.................................................... 194
56 -10.100IDP01505 amino acid ABC transporter, ATP-binding protein VCA1037 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  27..NKGEIVVICGPSGSGKSTLIRTV-SIDSGEIIVLPELDERTRRSGKIG-QHFNLFPHLTVLENLTLAPIRTLKLSAQEAKERAYHFLQRVKITDQTHKYPIQLSGGQQQRVAIARSL---CMQPEILLFDEPTSALDPETINEVLEVMVDLAQD-----GITMMCVTHEMGFARKVAHRVMFMDEGEILEV............... 214
57 -10.000IDP00151 gene: mshM; MSHA biogenesis protein MshM VC0403 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  39IEMGEGVSKLTGEVGTGKTMVCRMLLTHLGDEVALIYLPNPM--------------LSGEELRQAVAAELQLDVASP-VRVVEQIQTRLIELHQQGKRVVALVD---AQALSDEALETLRLFLAQHHLRQFRQRITFNQAETEVYIESRLQKA....................................................... 205
58 -10.000IDP00635 gene: modC; molybdenum ABC transporter, ATP-binding protein ModC SACOL2270 [Staphylococcus aureus subsp. aureus COL]  ali follow..  15  22..TEPKIYAVRGPSGIGKTTVLNMIAKADEAIIEVNGQLLTDTAKKIQQRRIGYLFQDYQLFPNMTVYKNITFMAEPSEHI----DQLIQTLNIDHLMKQYPMTLSGGEAQRVALARAL---STKPDLILLDEPFSSLDDTTKDESITLVKRIFNEWQ----IPIIFVTHSNYEAEQMAHEII......................... 198
59 -10.000IDP01501 maltose/maltodextrin transporter ATP-binding protein VCA0946 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  27..QEGEFVVFVGPSGCGKSTLLRCIAGEDITSGDLYIGEQRMNDVEPSKRGVGMVFQSYALYPHL----NLYDNMSFGLKLSKADKSEIKKRVDHAAEIL---ALSGGQRQRVAIGRTLVVFLLDEPLSNLDAALRVQMRSEITKLQRKLGCT-----------MIYVTHDQVEAMTMADKIVVLDAGFVSQ................ 214
60 -9.960IDP90888 RecName: Full=Cytidylate kinase; Short=CK; AltName: Full=Cytidine monophosphate kinase; Short=CMP kinase Q9KQT2 [Vibrio cholerae]  ali follow..  14  1MSSHTPVVTVDGPSGAGKGTLCMLLAKKLESEDALVPLATHLDVQFIAEGDLVKVILEGEDVSRELRKEETGMAASKVAALPRVREALLQRAFASGIGLVAD----GRDMGTVVFPAAEAKIFLDASAEERARRRFKQLQLKGLDVK--FDALLSEIQERDDRDRNRAVAPLRPAEDAL--VLDSTTLTIDEVVEQALQYIES..... 222
61 -9.910IDP00127 gene: sufC; cysteine desulfurase ATPase component NT01ST1705 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  25..RPGEVHAIMGPNGSGKSTLSATLAEVTGGSVTFK-DLLELSPEERAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRAYRGQASLDRFDFQDLMEEKIALLKMPEDLLTRKKRNDILQMAVLEPELCILDESDSGLDIDALKIVAEGVNALRDDKRAF----IIVTHYQRILDYIKPDYVH......................... 217
62 -9.890IDP06058 gene: coaE; dephospho-CoA kinase [Helicobacter pylori J99] NP_223488 [Helicobacter pylori J99]  ali follow..  16  5.....NAIALTGGIGTGKSTTLKILES-----QGYKILDADKIAHQLLQEHRL-----AQRFGSDILEKDILNRKKLGAIVFQNANEKACELEKNHQAYFLDIPLFFEVGGKKRYPVSRVVLIYAPRALQIE-RLLERDKLKEAEILQRLACQMDIEQKRAMSDYIIDNSSLKDLNKQVERFLKT....................... 194
63 -9.770IDP02756 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_2038 [Coxiella burnetii RSA 493]  ali follow..  12  41..SPGEIIGITGTNYSGKTTLLEFILGFHT-------------PTKGEIDGKNIENYDKMILREKIAARGQIFRGTLLENITMFRPERAKQALELSDHFGLSVGGGCSEILSRGVVQVVSTLISKPKILLSDEANALLDLKTDQLFLKILQSLKKRPSTLALADRLYELDSILKTHSNGRSL.......................... 240
64 -9.750IDP00760 maltose ABC transporter, ATP-binding protein, putative SACOL0192 [Staphylococcus aureus subsp. aureus COL]  ali follow..  12  28..TDKEFIVFVGPSGCGKSTTLRMVAGESITSGDFYIDGERMNDVEPKNRDIAMVFQNYALYPHM----TVFENMAFGLKLRKVNKKEIEQKVNEAAEIL---ALSGGQRQRVALGRAIVVFLMDEPLSNLDAKLRVQMRTEILKLHKRLNTT-----------TIYVTHDQTEALTMASRIVVLKDGDIMQ................ 215
65 -9.730IDP01660 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0776 [Coxiella burnetii RSA 493]  ali follow..  10  27..KRGQIVGLIGPNGAGKTTLLKSILGLTNYSGELNVLGLNPRSDRVKLMHHLCFIADVAILPRWIKVENLIE---FVEGVHPNFNREKALGFLNKTNIKMHQKVKELSKGMIVQLHLALVMAIDVEILVLDEPTLGLDILYRKNFFHTILNDYYNEKRTIIIATHQVEE-IESILTNLIMIDRGELLLESSMEEIAERF........ 220
66 -9.720IDP02084 gene: adk; adenylate kinase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0639c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  15  4......LFLIIGAPGSGKTTDASLIAQADATNIHYSTGDLLRAEVASGSE---------KTIDSFISKGNLVPLDVV--------INTIVYALKAAPTKTIIIDVEQMMEFDKVLSEQ-GVIEVRVSEEVAKERVLGRNRDNEEVFYNRMKVYTEPLNEILDF--IDGERTIEPIVADMKELIKK....................... 188
67 -9.700IDP06094 gene: engB; ribosome biogenesis GTP-binding protein YsxC [Helicobacter pylori J99] NP_224193 [Helicobacter pylori J99]  ali follow..  13  27.......MVILGRSNVGKSTFINTLLGK-------NLAKSSATP--GKTRLANFFSTTWEDKENALTTTFNV-YAKVSKSLKKEWEGFLWELLSVRVSIKLFIHLIDARHLDLEIDKNAKENIQALLRPDQAYLSLFTKFDKLNKNEQHRLFLNAPKPFLINTIHFNALSSKYPTLEIVRQTLLK....................... 201
68 -9.700IDP01669 ABC transporter ATP-binding protein [Yersinia pestis CO92] YPO3048 [Yersinia pestis CO92]  ali follow..  12  27..KRGEVVSLLGPSGSGKTTLLRAV-------------AGLEKPSQGHIDGSSHSEIEERNLGLVFQSYALWPHKTVSENVYPISTSEISQRVQAVLEQL---QLSGGQQQRVAIGRAL---VYNPPVILLDEPLSNLDAKLREEARVFLRELIMNLG----LSALMVTHDQNEAMAISDRILLLNNGKIEQ................ 220
69 -9.480IDP01423 gene: ugpC; glycerol-3-phosphate ABC transporter, ATP-binding protein VC1552 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  47..HQGEFIVLVGPSGCGKSSILRSIAGESITSGEIHLAGRRVDNEKPANRDIAMVFQNYALYPHM----SVYDNLAYGLKNRGVDKQTIAAKIAKVAKTL---KLSGGQRQRVAMGRAIVLFLFDEPLSNLDAALRAHMRLEIKKLQRELGVT-----------SVYVTHDQVEAMTLADRIVVVKQGEIEQ................ 234
70 -9.410IDP00717 phosphate ABC transporter, ATP-binding protein SACOL1421 [Staphylococcus aureus subsp. aureus COL]  ali follow..  15  60..YENQITAIIGPSGCGKSTYIKTLNR---------VELVPSVKTAGKIRDQDIFFQQPNPFPKSIYDN-ITYGPKIHGIKNKKVLDEIVEKSLRGAAIWDELSLSGGQQQRVCIARCL---AIEPEVILMDEPTSALDPISTLRVEELVQELKEKYT------IIMVTHNMQQAARVSDKTA......................... 249
71 -9.320IDP93923 urea ABC transporter ATPase protein UrtD [Yersinia enterocolitica subsp. palearctica Y11] YP_006005730 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  16  33..RRGEVRCVIGPNGAGKSTFFKLLHTPSEGDIRFF-RLNTLAPFQRIRMGMSIKFQIPGIFPELTVEQHLQLSLSHLRPEVSSQAVSVDELLERKLSAEYHQLAGNLSHGKKQWLEIAMAVSLQPTLLMLDEPVAGLSIDETYLTGELIKQMQGD-----GLTLMVVEHDMTFVRQIASQVT......................... 213
72 -9.280IDP00430 gene: sfuC; iron(III)-transport ATP-binding protein YPO2960 [Yersinia pestis CO92]  ali follow..  16  27..PPGSRTAIVGPSGSGKTTLLRIIAG-----FETPDAGKVILQGKAMFDGTTYVPAHKRGIGFVPQDGALFPHFTVAGNIYGLKGSQRDKERRINELMDM--EISGGQQQRVALARAL---AQRPVLMLLDEPFSALDTALRASTRKAVAELLSEAN----IASILVTHDQTEALSFADQVAVMRAGKLAH................ 216
73 -9.270IDP00099 gene: ynhD; putative ATP-binding component of a transport system NT02SF1983 [Shigella flexneri 2a str. 2457T]  ali follow..  17  25..RPGEVHAIMGPNGSGKSTLSATLAEVTGGTVEFK-DLLALSPEDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDG.................................................... 194
74 -9.170IDP00863 gene: ccmA; heme exporter protein STM2254 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  25..EAGEWVQVTGGNGAGKTTLLRLLTGLARPDGGEVYWQGEPLRRVRDSFHRSLLWIGHQP--GIKTRLTARENLHFFHPGDGARLPEALAQA--GLAGFEDVPVAQLSAGQQRRVALARLWLTRAALWVLDEPFTAIDVNGVARLTRRMAAHTAQ.................................................... 174
75 -9.160IDP01066 gene: ccmA; heme exporter protein STM3819 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  25..DAGEWVQVTGGNGAGKTTLLRLLTGLARPDGGEVYWQGEPLRRVRDSFHRSLLWIGHQP--GIKTRLTARENLHFFHPGDGARLPEALAQA--GLAGFEDVPVAQLSAGQQRRVALARLWLTRAALWVLDEPFTAIDVNGVARLTRRMAAHTAQ.................................................... 174

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24