current user: public

If you have questions about the server, please let us know.

Query: IDP06380 gene: ORF46; ORF46 [Human herpesvirus 8] YP_001129398 [Human herpesvirus 8], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
# Score Template Links and tools%idFirst MDAWLQQTVFRGTLSISQGVDDRDLLLAPKWISFLSLSSFLKQKLLSLLRQIRELRLTTTVYPPQDKLMWWSHCCDPEDIKVVILGQDPYHKGQATGLAFSVDPQCQVPPSLRSIFRELEASVPNFSTPSHGCLDSWARQGVLLLNTVLTVEKGRAGSHEGLGWDWFTSFIISSISSKLEHCVFLLWGRKAIDRTPLINAQKHLVLTAQHPSPLASLGGRHSRWPRFQGCNHFNLANDYLTRHRRETVDWGLLEQLast
1 -109.000IDP06380 gene: ORF46; ORF46 [Human herpesvirus 8] YP_001129398 [Human herpesvirus 8]  ali  100  1MDAWLQQTVFRGTLSISQGVDDRDLLLAPKWISFLSLSSFLKQKLLSLLRQIRELRLTTTVYPPQDKLMWWSHCCDPEDIKVVILGQDPYHKGQATGLAFSVDPQCQVPPSLRSIFRELEASVPNFSTPSHGCLDSWARQGVLLLNTVLTVEKGRAGSHEGLGWDWFTSFIISSISSKLEHCVFLLWGRKAIDRTPLINAQKHLVLTAQHPSPLASLGGRHSRWPRFQGCNHFNLANDYLTRHRRETVDWGLLEQ 255
2 -96.700IDP02504 gene: ung; uracil-DNA glycosylase [Francisella tularensis subsp. tularensis SCHU S4] FTT1578c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  42  2.............................TWSDILA-EEKQKPYFKQILDFLACESAGKVIFPTKENIFNAFKYTELDNLKVVILGQDPYHNYQAHGLAFSVQKGVDIPPSLQNIYKELARSIPEFKTPNHGYLVDWAKQGVFLLNTTLTVEAHKANSHKDIGWETFTDTVINKISENKHNVVFMLWGSHARKKKVLIDSSRHLILESTHPSPLSAHRG-------FLGCNHFVDCNKYLIEKKDQKIDWNLLC. 220
3 -6.230IDP01008 gene: sseA; 3-mercaptopyruvate sulfurtransferase STM2533 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  10..DWLAEHIDDPEIQILDARMAPPGQEHRDMAGEYRAGHIPGALFFDIEALSDRASPLPHMMPRPEAFAVAMRELGVRQDKHLVI----YDEGNLF--------------SAPRAWWMLRTFGAEKVSILAGGLAGWQRDEWLLREGEEAHEGGEFEAKFAPQAVVRLTDVLLASHEKTAQIV----DARPAARFNAQADEPRPGLRRGHPGALNVPWTELVYEGELKTTDELNEVFFSHGVSFDRPI....... 234
4 -5.970IDP92087 iron-containing superoxide dismutase [Toxoplasma gondii ME49] TGME49_116330 [Toxoplasma gondii ME49]  ali follow..  11  94....................................................................YAEDALAPHISAETLRFHHGKHHAAYVNKLNGFIQGTPFADKTLEDIVKNSSGAIAGGGGEPDGLLKKEIEAAFSSFAQFKDEFSKLAAGHFGSGW------------------AWIVWDKQQKKIVLEQTHDANTPITDTMKVPLLC----CDVWEHAYYLDKKNDRPAYIEG---SVVNWGFAAE 278
5 -5.880IDP04389 gene: pstS; phosphate ABC transporter, phosphate-binding protein [Clostridium perfringens ATCC 13124] CPF_0617 [Clostridium perfringens ATCC 13124]  ali follow..  10  38..................................ISGSTSVGPVMEAEAEAFKTKKPDVSIEINQIGSSAGIKNAMEGVSEIGMASRDLKGEEKQAGIALITHKNNPVKVQIKDIYT--------------GKITNWKELG----DAPIVVVSREDGSGTRDAFQEISGNIKSLVQGNENAIGYISFSYVDDSVSAVVEATPENVLNKSYK--VYKEENLTESGKSFIDFILSEEGQDIVAKEHLIKVK...... 276
6 -5.700IDP00844 acetyltransferase, GNAT family SACOL0519 [Staphylococcus aureus subsp. aureus COL]  ali follow..  10  12........................................................................DYDKSLNSIEESFDDNPETSWQARAKVKHLRKSPCYNFELEVIAKNENNDVVGHVLLIEVEINSDDKTYYGLAIASLSVHP----ELRGQK-RGLVQAVEERAKAQEYSTVVVDLGYQNAAEHDIKLEDAPLLVKYLWDNLTDAPHGIVKFPEHFY........................... 174
7 -5.650IDP04390 gene: pstS; phosphate ABC transporter, phosphate-binding protein [Clostridium perfringens ATCC 13124] CPF_0618 [Clostridium perfringens ATCC 13124]  ali follow..  10  34..................................ISGSSSVGPLVEAEAEVFKKEMPDITVEVNQLGSSAGIKDAINGTVEIGISSRDLKEKELESGMSVIINNENPVQEQIRDIYT--------------GKITNWKEVG----DTPIVLVSREDGSGTRDAFQEISGSIKTMVAGNKNAIGYISFSYVDDSVHAVVKPTAENVQNKKYK--VYKEENLNENSKKFIDFIMSKEGQEIVEEDGLISVT...... 272
8 -5.620IDP91042 AdeR [Acinetobacter baumannii] ACB0002 [Acinetobacter baumannii]  ali follow..  65............................................................KLPELNGWEVLNKIRQKAQTPVIMLTALDQDIDKVMALRIGADDFVVKPFNPNEVIARVQAVLRRTQFANKATNKNKIYKNIEIDTDTHSVYIHSENKKILLNLTLTEYKIISFMIDQRGELMNHCMNDSERTVDSHVSKLRKKLEEQGIFQMLVNVRG.................................... 232
9 -5.410IDP02231 gene: lisR; two-component response regulator [Listeria monocytogenes EGD-e] lmo1377 [Listeria monocytogenes EGD-e]  ali follow..  54............................................................MLPHLNGVEVCRRVRQVKQTPIIMITARDSVIDRVSGLDHGADDYIVKPFAIEELLARLRSLLRRVENAEQSAKQTTLQYRNLIVEKE-NRIVKRDEEIIDLTKREY--ELLLTLMENREVLLNKVWGYETEVETNVVDVYRNKIDHPDEESYIQTVRG.................................... 219
10 -5.290IDP01352 haemagglutinin associated protein VCA0447 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  20.................................................................MDAVDWLKTLENCSVDLFIT-DPPYEGTTTRLKESKSSSNQWFSVFPNTRFEELFREVYRVLKKGSHFYLFCDQETMFLAKPIA--ESVGFKFWKPIVWDKCAIGMGYHYRARYEFILFFEKGKRKLNDLSVPDVLEYKRVWKGYPTPVESSSENEIVADSFFGSGSTLIAANNLSRK............ 212

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24