current user: public

If you have questions about the server, please let us know.

Query: IDP06413 gene: vIRF-2; vIRF-2 [Human herpesvirus 8] YP_001129414 [Human herpesvirus 8], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680
# Score Template Links and tools%idFirst MPRYTESEWLTDFIIDALDSGRFWGVGWLDEQKRIFTVPGRNRRERMPEGFDDFYEAFLEERRRHGLPEIPETETGLGCFGRLLRTANRARQERPFTIYKGKMKLNRWIMTPRPYKGCEGCLVYLTQEPAMKNMLKALFGIYPHDDKHREKALRRSLRKKAQREAARKQAAAVATPTTSSAAEVSSRSQSEDTESSDSENELWVGAQGFVGRDMHSLFFEEPEPSGFGSSGQSSSLLAPDSPRPSTSQVQGPLHVHTPTDLCLPTGGLPSPVIFPHETQGLLAPPAGQSQTPFSPEGPVPSHVSGLDDCLPMVDHIEGCLLDLLSDVGQELPDLGDLGELLCETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSGQELPDLGDLSELLCETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSSFQASDNVDDFIDCIPPLCRDDRDVEDQEKADQTFYWYGSDMRPKVLTATQSVAAYLSKKQAIYKVGDKLVPLVVEVYYFGEKVKTHFDLTGGIVICSQVPEASPEHICQTVPPYKCLLPRTAHCSVDANRTLEQTLDRFSMGVVAIGTNMGIFLKGLLEYPAYFVGNASRRRIGKCRPLSHRHEIQQAFDVERHNREPEGSRYASLFLGRRPSPEYDWDHYPVILHIYLAPFYHRDLast
1 -234.000IDP06413 gene: vIRF-2; vIRF-2 [Human herpesvirus 8] YP_001129414 [Human herpesvirus 8]  ali  100  1MPRYTESEWLTDFIIDALDSGRFWGVGWLDEQKRIFTVPGRNRRERMPEGFDDFYEAFLEERRRHGLPEIPETETGLGCFGRLLRTANRARQERPFTIYKGKMKLNRWIMTPRPYKGCEGCLVYLTQEPAMKNMLKALFGIYPHDDKHREKALRRSLRKKAQREAARKQAAAVATPTTSSAAEVSSRSQSEDTESSDSENELWVGAQGFVGRDMHSLFFEEPEPSGFGSSGQSSSLLAPDSPRPSTSQVQGPLHVHTPTDLCLPTGGLPSPVIFPHETQGLLAPPAGQSQTPFSPEGPVPSHVSGLDDCLPMVDHIEGCLLDLLSDVGQELPDLGDLGELLCETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSGQELPDLGDLSELLCETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSSFQASDNVDDFIDCIPPLCRDDRDVEDQEKADQTFYWYGSDMRPKVLTATQSVAAYLSKKQAIYKVGDKLVPLVVEVYYFGEKVKTHFDLTGGIVICSQVPEASPEHICQTVPPYKCLLPRTAHCSVDANRTLEQTLDRFSMGVVAIGTNMGIFLKGLLEYPAYFVGNASRRRIGKCRPLSHRHEIQQAFDVERHNREPEGSRYASLFLGRRPSPEYDWDHYPVILHIYLAPFYHRD 680
2 -115.000IDP91679 gene: vIRF-3; vIRF-3 [Human herpesvirus 8] HHV8GK18_gp64 [Human herpesvirus 8]  ali follow..  17  7.......TWISEFIVGALDSDKYPLVKWLDRSTGTFLAPA-ARNDVIPLDSLQFFIDFKRECLSKGLHPRDLLGSPITAFGKICTTSRRLRRLPGEEYVVQGINCRRWRLLCAEVKECWWCVHARTHLHSGSSLWEILYQHSVRLEKHRRRPRPFVGENSDSSEEDHPAFCDVPVTQTGAESEDSGDEGPSTRH--------------------------SASGVQPVDDANADSPGSGDEGPSTRHSDSQPPPADETTVHTDNVEDDLTLLDKESACALMYHVGQEMDMLMRAMCDEDLFDLLGIPEDVI-------------------------------ATSQPGGDTDASGVVTEGSIAASAVGAGVEDVYLAGALEAQNVAGEYVLEISDEEVDDGAGLPPASRRRPVVGEFLWDDGPRRHERPTTRRIRHRKLRSAYYRVARPPVM-----------------------------------------------------------ITDRLGVEVFYFGRPAMSLEVERKVFILCSQNPLADISHSCHSRKGLRVLLPKPDDNGPGDVNLLAAVLRSFASGLVIVSLRSGIYVKNLCKSTVLYHGNNPPKKFGVICGLSSR-AVLDVFNVAQYRIQ-EHIKKTTVFIGGDPTSAEQFDMVPLVIKLRLRSVTCDD 566
3 -73.100IDP06369 gene: vIRF-4; vIRF-4 [Human herpesvirus 8] YP_001129412 [Human herpesvirus 8]  ali follow..  16  1MPKAGGSEWATLWIIDALENNKFPYFSWFDRNNLLFAAPALPAGSDIPPGWYSVYHAFDEECDRVYGPSPVVGQTVYGRFGRLLRGTRRARNDLRYSD---GGSYVVWQLVRTPFKNCTYCYGAAYGPEKLQRFIQCLLSPPM-------QTTATRRSDTREQSYEEAGAAAPAPPKAPSGLRGRPRKSNRYYNVGDITTEQKAACSVWIPVNEGASTSGMGSSGTRQVTQASSFTWRVPGDPPAPSTLTGPSDPHSPLAEPPATRPIRAPVWHPPVGHAVVPEVRTPLWIPWSSGGAPNQGLSHTQGGASATPSAGAPPTPEVAERQEGIPYVCQGDNMATGYRRVTTSSGALEVEIIDLTGDSDTPSTTVASTPLPVSGPRVFQPTVLYSAPEPAVNPEVSHLPTELERRECVCPGSGERPRVPLVSTYAGDRYAVGGYGPEQDICTWEEGLGNILSELQEEPSSSTRQATDRRR-------PRSRSPHGRRTPVSHSGPEKPPSKMDSQRVSFVVEIFVYGNLRGTLRREGDAGMLCSWPVGDTLGHLCQSFVPELLRIPRLTVPSPEQMEILNRVFEGLGHGFPIFCSMSGIYSRNATQVEGWWFGNPNSRYERILRSFSPR-VPQQLFNTARYLATTAAIPQTTVFFGASPASTENFQNVPLTVKIFIGSIW--D 908
4 -37.900CPX_91683_91679 Complex of MYC_HUMAN with Q9DUN1_HHV8 [Undefined organism]  ali follow..  22  453..............IVGALDSDKYPLVKWLDRSTGTFLAPAARNDVIPLDSLQFFIDFKRECLSKGLHPRDLLGSPITAFGKICTTSRRLRRLPEEYEVVQGINCRRWRLLCAEVKECWWCVHARTHLHSGSSLWEILYQHSVRLEKHRRRP--RPFVGENSDSSEEDHPAFCDVPVTQTGAESEDS------------------------------GDEGPSTRHSASGVQPVDDANADSP---GSGDEGPSTRHSDSQ----------------------PPPADETTV----------HTDNVEDDLTLLDKESACAL--MYHVGQE---MDMLMRAMCD-------------------------------------------EDLFDLLGIPEDVIATSQPGGDTDASG-TEGSIAASAVGAGVEDLAGALEAQNVAGE-LEISDEEVDDGAGLPPASRRRPVVGEFLWDDGPRR--HERPTTRRIRHRKLRSAYYRVARPPVMITDR---LGVEVFYFGRPAMSLEVERKVFILCSQNPLADISHSCHSRKGLRVLLPKPDDNNPGDVNLLAAVLRSFASGLVIVSLRSGIYVKNLCKSTVLYHGNNPPKKFGVICGLSSRA-VLDVFNVAQYRIQ-EHIKKTTVFIGGDPTSAEQFDMVPLVIKLRLRSVTCDD 1006
5 -34.400IDP91733 P88946_HHV8 [Human herpesvirus 8 type M]  ali follow..  14  2..........................................................................................................................................................................................................................................................DPGQRPNPFGAPGAIPKKPCLSQGSPGTSGSGAPCDEPSRSESPGEGP--SGTGGSAAAGDITRQAVVAAITEWSRTRQLRISTGASEGKASIKDWIVCQVNSGKFPGVEWEDEERTRFRIPVTPLADPCFEWRRDGELGVVYIRERGNMPVDASFKGTRGRRRMLAALRRTRGLQEIGKGISQDGHHFLVFRVRKPEEEQCV-------ECGVVAGAVHDFNNMARLLQEGFFSPGQCLPGEIVTPVPSCTTAEGQEAVIDWGRLFIRMYYNGEQVHELLTTSQSGCRISSALRDPAVHYCAVGSPGQVWLPNVPLACEIAKRELCDTLDACAKGILLTSSCNGIFCVCYHNGPVHFIGNTVPPDSGPLL--LPQGKPTRIFNPNTFLVGLANSPLVKLWLGKPVAVGKLEPHAPSPRDF......... 423
6 -19.500IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali follow..  1578...........................................................................................................................SVLLPADSEDGEKEQPKEKKKEKKEKKKKKDGETDAEPEEASAVLAPPPVPVPAAAIPSILLPTDGEDGEKEKTKEKKTEKKKEKHTEKKHKKKSEALPESETTAVVTVTPGEEDETSPLVPVPSSIASSEAPEPPASTRVTPAPAKPGLSMGAALLAVRARSRLQRKHLAQQLSSSSSSEVSASSASSLSPSSSSSSDFAETRAKADALRARLQAAQARLAAARETEVSSSETESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLAAYRRLEEENTRLAATRRRDDKLQRQVEAERERAVELLKEATRRAKEEKDLIARQPPPARDWSDTVVLSTPQIFVNSQAACAPFADSGRDEGGRDEWYEVSDACSRRAESSNESRTTAGA------QLDLAGR........................................................................................................................................................... 1989
7 -13.500IDP92738 gene: hsa; streptococcal hemagglutinin [Streptococcus gordonii] BAA97453 [Streptococcus gordonii]  ali follow..  1...........................................................................................................................MFFKRQKGQYHEVERVTRFKLIKSGKHWLRAATSQFGLLRLMKGADISSVEVKVAEEQSVEKGGLNYLKGIIATGAVLGGAVVTSSSVYAEEEQALEKVIDTRDVLATRGEAVLSEEAATTLSSEGANPVESLSDTLSASESASANSVSTSISISESFSVSASASLSSSSSLSQSSSESASASESLSVSASTSQSFSSTTSSTQSSNNESLISSDSSNSLNTNQSVSARNQNARVRTRRAVAANDTEAPQVKSGDYVVYRGESFEYYAEITDNSGQVNRVVIRNVEGGANSTYLSPNWVKYSTENLGRPGNATVQNPLRTRIFGEVPLNE................................................................................................................................................................................................................................... 330
8 -13.400IDP91949 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007099 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  767............................................................................................................................................PKLNQGTTRTAGNKIPVTFMANAYLDNQSTYIVEVPILEKENQTDKPSILPQFKRNKAQENSKLDEKVEEPKTSEKVEKEKLSETGNSTSNSTLEEVPTVDPVQEKVAKFAESYGMKLENV-LFNMDGTIELYLPSGEVIKKNMADFTGEAPQGNGENKPSENGKVSTGTVE------------------------------NQPTENKPADS----------LPEAPNEKPVKPENSTDNGMLNPEGNVGSDPMLDPALEEAPAVDPVQEKLEKFTASYGLGLDSVIFNMDGTIELRLPSGEVIKKN---SDLIA................................................................................................................................................................................................................................ 1039
9 -12.600IDP92613 RecName: Full=Serine-rich adhesin for platelets; AltName: Full=Staphylococcus aureus surface protein A; Flags: Precursor SAOUHSC_02990 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  2....................................................................................................................................................SKRQKAFHDSLANEKTRVRLYKSGKNWVKSGIKEIEMFKIMGLPFISHSLVSQDNQSISKKMTGYGLKTTAVIGGAFTVNMLHDQQAFAASDAPLTSELNTQSETVGNQNSTTIEASTSTADSTSVTKNSSSVQTSNSDTVSSEKSEKVTSTTNSTSNQQEKLTSTSESTSSKNTTSSSDTKSVASTSSTEQPINTSTNQSTASNNTSQSTTPSSVNLNKTSTTSTSTAPVKLRTFSRLAMSTFASAATTTAVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRID.................................................................................................................................................................................................................................... 305
10 -12.600IDP92737 platelet-binding glycoprotein [Streptococcus sanguinis SK36] YP_001034807 [Streptococcus sanguinis SK36]  ali follow..  4...............................................................................................................................................................KRQKGKYHEVERVTRFKLIKSGKHWLRAATSQFGLFRSMKGGGLSSIELKVTEEQVTDKKSGIDFLRGIVATGAVLGGAVVTSTTVHAEEGQALEKVIDTTDVLATRGETVLGEESSAAEAATATASSHTESESVSDTSSASASASVSASISASISASESMSQFSSASISASTSQAVSDSLSVSESLSVSSSTSDSVSASQPASTSASSKSESTVNSQSASSETNRSSTNNGSTSSSSETARVRKRRATDTTPPTITVPSDIIAYRGEEFEFYFEITDDSGQVKNIELSTFGK.................................................................................................................................................................................................................................... 296
11 -12.000IDP92699 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus USA300_TCH1516] YP_001574462 [Staphylococcus aureus subsp. aureus USA300_TCH1516]  ali follow..  2............................INRDN-------KKAITKK---------GMIS-----------------NRLNK--FSIRK------YTVGTASI------LVGTTL----------------------IFGLGNQEAKAAENTSTE--NAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDGKDNVAAAHDGKDIEYDTEFTIDNKVKKGDTMTINYDKNVIPSDLTDKNDPIDITDPSGEVIA................................................................................................................................................................................................................................ 358
12 -11.900IDP06012 membrane-attack complex / perforin domain-containing protein [Toxoplasma gondii ME49] EEB00555 [Toxoplasma gondii ME49]  ali follow..  10  4...................................................................................................................................................................................................................................SAIGGIGPTESRLQHIPFSTTRYLPIRSHVLQSTVERIESPEALN----------EVPTKVERNEFTEKGDKTEQVLTAQAD--HKSLLEGRSVRLESTSTAPDDDFDFLFEDDTPKKPKSRVNKGTSSDETSPGDRSSGEGSSDSDSLLSVVHRTKGNATQANKNQTRITHPKSKAQHQKKVTKKQGIPGSDSLGTSSADFDFDIDSSSNTQADDSQRQSLGDSSALDLFGSDTGDTGDIFGFSNSSS............................................................................................................................................................................................................ 240
13 -11.900IDP06528 gene: scm; collagen-binding MSCRAMM Scm (Fms10) [Enterococcus faecium DO] AFK60297 [Enterococcus faecium DO]  ali follow..  277...........................................................................................................................EMTDLTISAPFQGTILAPNATIRITQNQDGTIIGTNVILDAATNRWDPNEIFISDNGTDTTDTSDSTDTSTTSDSSDSSTSSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTSTTTSDSTDTSASSDSTDTTSTTSDSSDSSTTTSDSTDTSASSDSTDTSSTTSDSSDSSTSSDSTDTSSTTSDTRHASVSFSKTSSDNRTNFNLTNKTSNDNGNKSKRALPKTGSQSNNWITLAGVILLVIGLRITFMSYKKSKR...................................................................................................................................................................................................................................... 603
14 -11.300IDP92687 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus str. Newman] YP_001331559 [Staphylococcus aureus subsp. aureus str. Newman]  ali follow..  2............................INRDN-------KKAITKK---------GMI------------------NRLNK--FSIRK------YTVGTASI------LVGTTL----------------------IFGLGNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSS--STQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDGKDNVAAAHDGKDIEYDTEFTIDNKVKKGDTMTINYDKNVIPSDLTDKNDPIDITDPSGEVIA................................................................................................................................................................................................................................ 358
15 -10.900IDP05386 hypothetical protein BA_2029 [Bacillus anthracis str. Ames] BA_2029 [Bacillus anthracis str. Ames]  ali follow..  2....................................................................................................................................................KRRIGTAVVGLSVLGFGIFGFTHGNGGGVVQAASEGDGGGAPAYAHGNHGGAPTYTHGEGWSPSYAHGHTGGAPSYTHGHTGAPVYGYGDYPIPSFNVGDTPAPRLDADGDHGGAPTYTPAPKLESDGYTGGAPSYNKEDTWSPSYAHGNTGAPSNTEPGG................................................................................................................................................................................................................................................................................................................................................................................... 166
16 -10.500IDP90350 hypothetical protein CT456 [Chlamydia trachomatis D/UW-3/CX] CT456 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  7...........................................................................................................................GYQPTVTTSTSSTTSASGASGSLGASSVSTTANATVTQTANATNSAATSSIQTTGETVVNYTNSASAPNVTVSTSSSSTQATATSNKTSQAVAGKITSPDTSESSETSSTSSSDHIPSDYDDVGSNSGDIS-NNYDDVGSNNGDISSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSDGAAAAALNSLRGSSYTTGPRNEGVFGPGPEGLPDMSLPSYDPTNKTSLLTFLSNPHVKSKMLE.................................................................................................................................................................................................................... 350
17 -10.500IDP05117 putative collagen-binding protein [Clostridium difficile 630] CD2831 [Peptoclostridium difficile 630]  ali follow..  12  18.......................................................................................................................................................................SMVVSTIYPTVSYASELGENSQIQSGSTNSSTGEEKESDNKKPEQTPEKDKATDNKKPEQTPEEEKPTDNKKPEQTPEEDKSTDNKKPEQTPEGEKPIDN-KKPEQIPEEDKSTDNKKSEQALEDEKPLDNKNTEKTPEEDNLLEDENLLKVLEEELNEENED.............................................................................................................................................................................................................................................................................................................................................................. 179
18 -10.400IDP06534 Surface protein from Gram-positive cocci, anchor region [Enterococcus faecium DO] EAN10892 [Enterococcus faecium DO]  ali follow..  19.................................................................................................................................................................................AMIGISTSANERANENLSFTVKTDRIVYDMTQQVITIPVKPNKSVNASDVHAVLTYGWDGNGSSEKVIGEVYLKDVQWTAGIEYTIMISAELSIDEIKSKDKVDLIVFYDGQMTITENLKPSSWTVVGPPSSTDSTSSESSTENTSGESSTESTSSESSTENTSSESSTESTSSESSTGSTSSESSTESTSSESSTGSMSSESSTGSTSSESSTGKVNNELDLVPIIPTKEQKRNAGSNLKSVLKQPDFVSRGIDHQEKAKETDNRKSDLPETGS.................................................................................................................................................................................................................................... 293
19 -10.200IDP06379 gene: ORF45; ORF45 [Human herpesvirus 8] YP_001129397 [Human herpesvirus 8]  ali follow..  73...........................................................................................................................................PPATPLDLQISPDQSSGESEYDEDEEDEDEEENDDVQEEDEPEGYPADFFQPLSHLRPRPLARRAHTPKPVAVVAGRVRSSTDTAESEASMGWVSQDDGFSPAGLSPSDDEGVAILEPMAAYTGTGAYGLSPASRNSVPGTQSSPYSDPDEGPSWRPLRAAPTAIVDLTSDSDSDDSSNSPDVNNEAAFTDARHFSHQPPSSEEDGEDQGEVLSQRIGLMDVGQKRKRQSTASSGSEDVVRCQRQPNLSRKAVASVIIISSGSDTDEEPSSAVSVIVSPSSTKGHLPTQSPSTSAHSISSGSTTTASRCSDPTRILASTPPLC.......................................................................................................................................................................................................................... 396
20 -10.200IDP91504 putative translocation protein in type III secretion [Vibrio parahaemolyticus RIMD 2210633] VP1670 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  4.....................................................................................................................................................KPSTDTP---STQPHSPQSPMPIDDHAMLQSRFERALKENPDQTKPQPNETNNQAALEAKKPFTENYSERSLASLHSTGSNQRKTAEKSAFAQNNDVVTENINNESDTSSPIALNTQDKMPSDMDANMKPDIRIPTTGDKKLPMEPSNKREKNADEQDAFERLVEDHDDSKTELAAAKTAESHESTQ---SPKDTKHIPTAGTKPNTVETVSDALASTLASTTVASATSASLASHPVTSTVHKTATKTEVNKHEGDSSLGFNSRNLKTPIPNDEHPKASQAERTLLDRAMLDSEKSNDKPMHQPVTTPITQ............................................................................................................................................................................................................................ 308
21 -10.100IDP90339 hypothetical protein CT050 [Chlamydia trachomatis D/UW-3/CX] CT050 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  260...............................................................................................................................................................PDTSDSSGSGSENPADPAPTNPSDSNAQNNPTPSSNGATASIRKLAATTTTVPTDTEIAPAAEDPNLPNTTFSEKSPLWEEFFSFSDSSRSEMVIQKTGILTFSMQGTWENPSSSQTPSTDPISLELTVTPPTTDTPPESPPSPPEAPAPEATPSPTNNNLTASITKTFSRKYNLSATPSPTPTTPTEPTTITKTLSLSSGQSCTLQIPVQATRSVLKLKYVNPNNNSSGGSSGSGGSSQPETTPTGITLQSFSWSLVLTPGEITKATSTPSTPSQP.................................................................................................................................................................................................................................................... 536
22 -10.000IDP06468 gene: A5L; A5L [Monkeypox virus Zaire-96-I-16] NP_536542 [Monkeypox virus Zaire-96-I-16]  ali follow..  9..........................................................................................................................................................................QGLAESSTPKSSIYYSEEKDPDTKKDEAIEIGLKSQESYYQRQLREQLARDNMMVASRQPTQPLQPTIHITPQPVPTPTPAPILLPSSTA---PVLKPRQQTNTSSDMSNLFDWLSADTDAPASTLLPALTPSNTVQDIISKFNKDQKMT---------------------TPPSTQPSQTLPTTTCTQQSDGSISCTTPTVTPLQPPIVATVCTPTPTGGTVCTTAQQNPNPGAASQQNLDDMTLKDLMSSVEKDMRQLQAETNDLVTNVYDAREYTRRAIDQIIQLVK............................................................................................................................................................................................................................ 274
23 -9.990IDP92612 gene: gbs1529; Unknown [Streptococcus agalactiae NEM316] CAD47188 [Streptococcus agalactiae NEM316]  ali follow..  566...............................................................................................................................................................TSQYSYTNDGSKITIDWKTNSISSTTSYVVLVKIPKQSGVLYSTVSDINQTYGSKYSYGHTNISGDSDANAEIKLLSESASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMSASMSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTS.................................................................................................................................................................................................................................... 858
24 -9.750IDP05070 putative surface protein [Clostridium difficile 630] CD3246 [Peptoclostridium difficile 630]  ali follow..  1........................................................................................................................MVFTAFTPIVSYADEVTSNDTILNGEEQSNGQTPDVEKPSDGQVPGGEKPSDSQVPDGEKPSDGQVPDGEKPSDGQIPDGEKPSDGQIPDGEKPSDGQIPDGEKPSDGQMPDGEKTSDSQTPDVEKPSDGQMPDGEKPLDEQTPEEEKPLEEEIVIEEMSLKQDIDKILDMTLSQINKIVYNFWEDEEDVKADEQSEINQVDSFISLWYDKKAKVKNSCLLKEIDGSDRPYHDLRFDDITKTLTFDYVIKGLVGASSKDDKYVIEGEDGEQTAFCYNNHLRPPSSNGKSPYLPAEDFNGQENQNEEAVKSILYAGSEFDGFGYKQQFNLGGEE................................................................................................................................................................................................................................... 337
25 -9.590IDP00768 superantigen-like protein SACOL0470 [Staphylococcus aureus subsp. aureus COL]  ali follow..  1........................................................................................................................................................................MKMRTIAKTSLALGLLTTGAITVTTQSVKAEKIQSTKVDKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAPNTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQAQT.............................................................................................................................................................................................................................................................................................................................................................. 162
26 -9.550IDP06537 Surface protein from Gram-positive cocci, anchor region [Enterococcus faecium DO] EAN08832 [Enterococcus faecium DO]  ali follow..  334...........................................................................................................................TDTTDTSDSTDTSTTSDSSDSSTSSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTSTTTSDSTDTSASSDSTDTTSTTSDSSDSSTTTSDSTDTSASSDSTDTSSTTSDSSDSSTSSDSTDTSSTTSDTRHASVSFSKTSSDNRTNFNLTNKTSNDNGNKSKRALPKTGSQSNNWITLAGVILLVIGLRITFMSYKKSKR...................................................................................................................................................................................................................................... 660
27 -9.530IDP91616 gene: ECs2715; EspF-like protein [Escherichia coli O157:H7 str. Sakai] BAB36138 [Escherichia coli O157:H7 str. Sakai]  ali follow..  17......................................................................................................................................................TAVYKKSSFSVSPQKITLNPVKISSPFSPSSSSISATTLFRAPNAHSASFHRQSTAESSLHQQLPNVRQRLIQHLAEHGIKPARSMAEHIPPAPNWPAPPPPVQNEQSR----PLPDVAQRLVQHLAEHGIQPARNMAEHIPPAPNWPAPPLPVQNEQSRPLPDVAQRLVQHLAEHGIQPARSMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQSRPLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTPPVQNEQS...................................................................................................................................................................................................................................... 312
28 -9.510IDP00769 superantigen-like protein SACOL0472 [Staphylococcus aureus subsp. aureus COL]  ali follow..  2..............................................................................................................................................................................................KITTIAKTSLALGLLTTGVITTTTQAANATTPSSTKVEAPQSTPPSTKIEAPQSKPNATTPPSTKVEAPQQTANATTPPSTKVTTPPSTNTPQPMQSTKSDTPQSPTTKQVPTEINPKFKDLRAYYTKPSLEFKNEIG................................................................................................................................................................................................................................................................................................................................................................ 139
29 -9.120IDP92610 gene: srr-2; serine-rich repeat protein [Streptococcus agalactiae] AAZ95526 [Streptococcus agalactiae]  ali follow..  11...................................................................................................................................................EKSRKVRVKMRKSGKHWVKSVMTQIGYVILSRFSGKEKSSKVQTTSEDLSRTKTSASILTA--------------AALGAVVGGTTDTTSVSAEETPTATELTGNEKTLATAETVVVAPEVKTVNSDSSSHSTSESQSMSTSTLQSTSASLSASESLMDSTSASLSESSSLSEYSSLSLSSSESVSASESVQSSEAATTARVQPRAMRVVSSASDMETLPAALISGEGDVTTVQGQDVTDKLQNLDIKLSGGVQAKAGVINMDKSESMHMSLKFTIDSVNRGDTFEIKLSDNIDTNGASNYSIVEP................................................................................................................................................................................................................................... 303

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.