current user: public

If you have questions about the server, please let us know.

Query: IDP90117 virokine protein [Monkeypox virus] MPXV_ZAI1979_005_027 [Monkeypox virus], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MRTLLIRYILWRNDGDPSYYNDDFKKLILFDELVDDDDVCTLIKNMRMTLSDGPLLDRLNQPVNNVEDVKRMIAISAKVARDIGRRSEIRWEDSFTILFRMIEKYFDDLMTDLYGEKLast
1 -86.200IDP90117 virokine protein [Monkeypox virus] MPXV_ZAI1979_005_027 [Monkeypox virus]  ali  100  1MRTLLIRYILWRNDGDPSYYNDDFKKLILFDELVDDDDVCTLIKNMRMTLSDGPLLDRLNQPVNNVEDVKRMIAISAKVARDIGRRSEIRWEDSFTILFRMIEKYFDDLMTDLYGEK 117
2 -49.100IDP90206 gene: m146R; m146R MYXV_gp149 [Myxoma virus (strain Lausanne)]  ali follow..  26  4.EATIKRYIRWRGGDLDVPYEDVFETYTEFDAVAFGECGYDLIKPMKLTLTDGPRLGKLPTK--EPMTPEEAIGLCGLLAEKVTHSYNVNWDVVFDELFSVMKR............. 108
3 -26.100IDP90217 gene: m003.1L; m003.1L, m3.1 MYXV_gp004 [Myxoma virus (strain Lausanne)]  ali follow..  16  16VILAVQDYLRWSAFRDRESAGRLFAVFESFKRDAFRDNVRWLVRCSYEHVDSSESLIRMLRHDSYITEACAIIGLLARVAEYWGYDPIPTSVRVIELFMRLITDYVPHLRSVIN... 137
4 -25.900IDP06460 gene: N1R; N1R [Monkeypox virus Zaire-96-I-16] NP_536612 [Monkeypox virus Zaire-96-I-16]  ali follow..  16  26VRHCLTEYILWVSWTHRESAGPLYRLLISFRIDAFGSELKEFSDSLPWNIDNCVEIIKCNDSMKTAKELCAIIGLCTQSAIVTGRVFNDKYIDILLMLRKILNELLDHILTAKY... 153
5 -24.600IDP90210 gene: m136R; m136R MYXV_gp140 [Myxoma virus (strain Lausanne)]  ali follow..  15  47IKHVLEEYFSWRACIIPNHVGKLYIKLTKLDTTALGNLDILLCDVLKIDEDGGNQFIRSLNLHKNKENTLTLIGLLAYACNFWGSQINKYIPSIMPFFLKQTTESLSELCVILN... 174
6 -24.000IDP90112 unknown [Monkeypox virus] MPXV_ZAI1979_005_019 [Monkeypox virus]  ali follow..  13  17IKDVIHDYICWLSDETRPSIGNVFTAMETFKIDAYDGNIYDLAKDINTSFDSFIRSLQNITSKKDKLTVYGTMGLLSIVVDINKGRNIKFAAGIIILMEYIFDDTLSHLKIALY... 140
7 -23.200IDP90208 gene: m139R; m139R MYXV_gp143 [Myxoma virus (strain Lausanne)]  ali follow..  25  53IVSILHNYIWYRGFGLPNKYGRVFKELKLFDIDAK-GDINTLFFMLNLNSDRCCRQKTIFKHTVTVYNCIEMIGLCALVAEQWKNNKCLNWRIVVDEMFRFIDPDLEKIRTVLYED. 186
8 -23.000IDP90123 B15R-like protein [Monkeypox virus] MPXV_ZAI1979_005_035 [Monkeypox virus]  ali follow..  22  26IIDLIDEYITWRNNKDITSCGRLYKELIKFDDAAYGIDKINEIVEAMSEGDHYINLTEVH----DQESLFATIGICAKIAEHWGYKISESKFQSLGNITDLMT.............. 133
9 -21.600IDP90142 unknown [Monkeypox virus] MPXV_ZAI1979_005_188 [Monkeypox virus]  ali follow..  15  26VRQCLTEYIYWSSYRNRQCAGQLYGTLLSFKDDAE-IDVRELVKNMPWDNVKDCT---IPDEQKTIREISAIIGLCAYAATYWGG--EDHPTSNSLNALFVMLGMLNYMDYTI.... 143
10 -16.900IDP90134 Toll/IL1-receptor [TIR]-like protein [Monkeypox virus] MPXV_ZAI1979_005_166 [Monkeypox virus]  ali follow..  16  91FKPILAEYIRHRN----TISGNIYSALMTLDDLVYGDIDLLFNEKLKVDSDSGLFDFVNFVKDMICCDSRIVVALSSLVSKHWELTKKYRCMALAEHIADSIP.............. 193
11 -10.700IDP90118 alpha-amanitin target protein [Monkeypox virus] MPXV_ZAI1979_005_028 [Monkeypox virus]  ali follow..  13  53IIAILDRFLMMNKDELNNTQCHIIKEFMTYEQMANQHHTIDLFKRIKRTRYDTFKVNPVE--------VKKVIGFVSILNKYKPIYSYVLYENVLYDELKCFIDYV........... 170

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24