current user: public

If you have questions about the server, please let us know.

Query: IDP90329 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_548 [Chlamydia trachomatis D/UW-3/CX], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MLKMFWLNSLVFFSLLLSACGYTVLSPHYVEKKFSLSEGIYVCPIEGDSLGDLVSSLSYELEKRGLHTRSQGTSSGYVLKVSLFNETDENIGFAYTPQKPDEKPVKHFIVSNEGRLALSAKVQLIKNRTQEILVEKCLRKSVTFDFQPDLGTANAHQLALGQFEMHNEAIKSASRILYSQLAETIVQQVYYDLFLast
1 -91.300IDP90329 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_548 [Chlamydia trachomatis D/UW-3/CX]  ali  100  1MLKMFWLNSLVFFSLLLSACGYTVLSPHYVEKKFSLSEGIYVCPIEGDSLGDLVSSLSYELEKRGLHTRSQGTSSGYVLKVSLFNETDENIGFAYTPQKPDEKPVKHFIVSNEGRLALSAKVQLIKNRTQEILVEKCLRKSVTFDFQPDLGTANAHQLALGQFEMHNEAIKSASRILYSQLAETIVQQVYYDLF 194
2 -57.000IDP06182 hypothetical protein jhp1453 [Helicobacter pylori J99] NP_224171 [Helicobacter pylori J99]  ali follow..  14  1....MRVLLFFILLLWFKGCGYKPIATY---AQNALGDSVYVKLIVNLPSVEFKDLMNRLVVQRFQNRLASEKDADSIIIIEITNVTDTSITQNKEG------------FTTFYRATVSVNYTYDNKRGTQKTFQNSGYYNYAVNLQDPL--------------NTFQNRYYAINQAVEQTLTKFVAQIAYEG. 164
3 -49.600IDP92719 hypothetical lipoprotein [Francisella tularensis subsp. tularensis SCHU S4] FTT0991 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  10  4VRYIHTIFLFILSVVLLASCGFHPRGV---LSDGNAGNFDSLVYIKADNFANFANALKRNLTNYNAIVVNDEKSADYIINIQDVKQESQLTSIVGG------------ASNNTFQLIYTVTYNVVKPDDKTPVIPRSINAQQFWQSNSGTQLAQNNE------------ANRIYSYLEGQLVNNMATQIAA... 172
4 -27.500IDP93848 lipoprotein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005557 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  12  1MMKKIFLATTLITTVLLSGCATESSRSLEVAKVTSYGSPISVGKFDNRSGNQSKTILVTHLQQTGRFNVLERTNATYVVTGDVTEFGRKETG--------DRQLFGILGRGKSQVAYAKVNLNIVNVNTSEVVFSSQGAGEYELSNREVIGFGGTASYD-------STLNGKVLDLAIREAVNNLVAGIESGAW 219
5 -22.400IDP93852 lipoprotein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005559 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  15  1.MKAIFAVCAVMMALLLTGCA-KPVSQDYSAFKQSKPKSILVLLPQNQSPEVMLSQVTYPLSEAGPAKLHKIFGADAALYITIVQYGTSYQILTS-------------------DTRVTANAKLVDLKTGKLLWSGSATASSDEGNNSSGGIIGMLVQAAVSQTMTDKSHDIAAITSARMLSAGTPNGILYG.. 207
6 -18.500IDP06159 hypothetical protein jhp0866 [Helicobacter pylori J99] NP_223584 [Helicobacter pylori J99]  ali follow..  12  1MNKKHRLGLIVGVLFFFSACQ-GYYSEVTGDYLFNYNSTIVVAYDRSDAMTSYINVIVYELQKLGFYNVFTQAEFPLDKAKNVIYVRIVR-QFYCSQTPTDYYAINGFSEQILMSANSHFILDWYDVVLQKRVLYVDGSV---------------------------SGRTCGYQMLYRDLIKSTIKRI..... 196
7 -15.500IDP05430 hypothetical protein lmo1265 [Listeria monocytogenes EGD-e] lmo1265 [Listeria monocytogenes EGD-e]  ali follow..  1MKNRITMIAGIVCLSILTACSSSESVKGTTSEEQTTSQSGAEMIKANNGVVSYHGKYLKLAENMDNLE----KDAPIIIKATKKSEKTTVTKETKENVFPTDFYTMSDVQINSITIKVL-GYKNMEKGEEYTLFLEKNPDGDNYILSNAVISKFPVEELSEEELFLDGGQATEETDSIEEIYQEVYQEVLEEY. 219
8 -14.700IDP05460 putative lipoprotein [Bacillus anthracis str. Ames] BA_0985 [Bacillus anthracis str. Ames]  ali follow..  12  1MKKIISICALTALSFTLIGCASTSATDKSPQAKQENITDIEILQTTNNTTQSIVSAVQKGTPKTITLDQKKRKSAHSTITVTYKDDAKEEFLV-DNKEQITIAKDKKKDKVEGVTVNIKNTKMMKD.................................................................... 149
9 -14.600IDP05592 putative lipoprotein [Bacillus anthracis str. Ames] BA_3194 [Bacillus anthracis str. Ames]  ali follow..  11  1MKILKFGIIGALSITLLIGCTSNSNETKASNKEAKEVRKLEISPVNSKSSKTIFTSMESAEKKTLLLDQEAKNYIHSKMKVTYQDNSIQEFFV-ESDSDIVIAKASDETHGEGYDLREDNSKKIIQFFEKEF.............................................................. 160
10 -14.400IDP90372 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_253 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  11  1MRKLASFGLLSLTTTTLSSCAYNARLYTKGSKAKGVVAMLPVFYRTEKSQAEFSEEISRRLHSSDKLLLIKHHASAGVAAQFFSPTPNISPELATQLLPAEFVVAAEILEQKTTSISASVRVRVFDIRHNKMIYQEILDASQSLASGSNDYHRYGWRSKNFDSTPMGLMHQRLFREIVARVEGYVC........ 211
11 -14.300IDP01612 hypothetical protein FTT1538c [Francisella tularensis subsp. tularensis SCHU S4] FTT1538c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  1MQKRL-ITFLVSSMSFMTATGVAAQNNLADTNMKLKMFRVAILPFDTKGQSGLNDSIVAQITQSRKFRVSNRDVADFILTGDILNLNIT-----------KNKTSYYGEDFTTLNVSATVAYRMVELATMEVKWSNVVTIEVP------------TNIANQYANADDANYMQLLSYLGKQLGKTISDQVIGAIY 240
12 -13.700IDP02672 hypothetical protein FTT1602 [Francisella tularensis subsp. tularensis SCHU S4] FTT1602 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  42  1MKKQLFAISITTALLVLSACG............................................................................................................................................................................. 21
13 -13.600IDP05267 hypothetical protein lmo0255 [Listeria monocytogenes EGD-e] lmo0255 [Listeria monocytogenes EGD-e]  ali follow..  19  1MKKFLSILSILVLALLVTACGSDSSDKKSAKKEEKMETVTYIADINGAKLEATFSHVGDNLRKVDQKMVYPLTALGLESGANLDDATKKQLE-SQYSAYKESKGASLETKFTDEALELTMSVDLYKADKDSV.............................................................. 135
14 -12.800IDP05580 putative lipoprotein [Bacillus anthracis str. Ames] BA_0936 [Bacillus anthracis str. Ames]  ali follow..  33  2LKKLGILVLGSAVALSLVACG............................................................................................................................................................................. 22
15 -12.600IDP05242 hypothetical protein lmo2079 [Listeria monocytogenes EGD-e] lmo2079 [Listeria monocytogenes EGD-e]  ali follow..  12  1MKKGILLSILLALVLVISACG-----ESAEEKAAKTPQGKFVQTMKNGMNVPDQYTYTTSFAVNDINVSSTDPSAQTM---ILKDIKLSVTTSTDKKANKSEAKFNVTSTNNLLPISMDLDFLVDSKTGNAYIPLKTIVEPDASLLSYLDQATGGMWSKINTDYPDLKNKYLSTEELTSSLTDQ.......... 177
16 -12.200IDP05658 hypothetical protein lmo0207 [Listeria monocytogenes EGD-e] lmo0207 [Listeria monocytogenes EGD-e]  ali follow..  10  4LKKGTAVLFVMIMAVMLVACG----DKEETKTYTLSQNGVDSKLTYTYKGDKVTKQTAENTMSYASLGVASKEDAEKMLKATSDKFQ-------------GIDGLKEKIEYKDDKAIETLEVDYTKISSEDM.............................................................. 118
17 -11.800IDP05010 putative lipoprotein [Bacillus anthracis str. Ames] BA_4934 [Bacillus anthracis str. Ames]  ali follow..  1MKKVLMLFVLLTASILLIGCS---TKKEKAGMNLEKAQKVEIESLTDSTDKKEIEKLFEVMKMDKWEMQSAPLDTPQGKTFKMYQEDTTKLSESSKDKKE----LHEIGTMTVYKDVPYVEVEMKNKKMSFKVPEDVAKDLLKY.................................................. 144
18 -11.700IDP05429 hypothetical protein lmo0791 [Listeria monocytogenes EGD-e] lmo0791 [Listeria monocytogenes EGD-e]  ali follow..  10  1MKKLFSMVLVLAMVLVLSACG-------ASRVEPKKAGEITVNAVVYNKDTDKVKDVYGE--DGSKFEKEFETSFKESFISTFTASFSSDVNLDKQVDEFYDALRKQVNEKTSYTTSPEIQFAIKGLDMKGVQTELVEELTKAATADPSIASDDQKMAEKTMEIYTKAVQNADAVSEAKTVTLKLKAD--DSLW 195
19 -11.100IDP05121 conserved hypothetical protein [Bacillus anthracis str. Ames] BA_0915 [Bacillus anthracis str. Ames]  ali follow..  2LKKFTTCILGGALVFNLSGCG---NTSDKTSSESKETNSKQEEKNVQTTDEAKTKENTKQKNTEQTKEKSKIKEKEYAVNKDFHTPKFDVTVKRVVERDKVGKESIGFQKPEDGHVFIVVEAEGKNITSEPM.............................................................. 130
20 -11.100IDP04392 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1500 [Clostridium perfringens ATCC 13124]  ali follow..  1MRVLKGVILAIIPAFLFMGCG------------FSKNDVAKVSFEKSEKEEQILNLTDNRVFFYKVKNISKNKGYRIDLNYEVYKEGK-TLGINFKDDNRINCLLGGDGAYSRHNYKAEENIKDYFSANFAGDYDLELEKGKRVCLYYATLGNGISSNVIGMNMDSEEIKETINR................... 186
21 -11.000IDP05483 putative lipoprotein [Bacillus anthracis str. Ames] BA_3005 [Bacillus anthracis str. Ames]  ali follow..  1MRRMLLIIISAIAAFALAACTGNKVDESTSKNFISKAEEI-VSLLNEAKYKEVHEKFDSKMTAALSEEKMKDLTPIIEKAGTFEKIEKQSIE-EKDGLYTVILVAKYSKEQRTFIITYNDKEEIAG.................................................................... 124
22 -10.900IDP05148 putative lipoprotein [Bacillus anthracis str. Ames] BA_0177 [Bacillus anthracis str. Ames]  ali follow..  18  1MKKIIFVSSLVLAISLGVGCSNEKTAKTDEPKKESVQKE------KELTAKDVFKKTNEAFKNEEHVTMTYGVGVKA..................................................................................................................... 71
23 -10.900IDP05508 putative lipoprotein [Bacillus anthracis str. Ames] BA_5398 [Bacillus anthracis str. Ames]  ali follow..  14  1MTIRKRTSFIWIFLFSLVACSPPNTTIDKKNDVVVKGTGIFVLNVEQVKVDKIRDPIFQTLERSKNDILYASDNR....................................................................................................................... 91
24 -10.700IDP91374 outermembrane lipoprotein [Vibrio vulnificus CMCP6] VV1_1919 [Vibrio vulnificus CMCP6]  ali follow..  12  1MKN---IGLLLLASLFLAGC------TTPTHLPLSGSQAIEIRIDDQFN-GTVTGNEGHWYSYLFFSNDTMMQGAVNDLKNNAKELDADTIFVIAPQAFVTSFSLLGTA..................................................................................... 106
25 -10.600IDP05662 putaive secreted, lysin rich protein [Listeria monocytogenes EGD-e] lmo0303 [Listeria monocytogenes EGD-e]  ali follow..  16  1MSKKLVSIIFLGICLLLVGCGKEVVDSKYTGKWKLESSGIGMSDGSNYKETDAAGKVSLDLDIDASYKLKKKGDDEYQYDGTLISKKVYSYETESDKEKDNVKITKNEQKGDEYHIDVKADFVFSLEMQSGKLIFKKVDTKEKVLIKE.............................................. 179
26 -10.600IDP04565 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1805 [Clostridium perfringens ATCC 13124]  ali follow..  13  2IKKIVVAVGLAFSLSFLVGCG------------------------------------NKSLVEQGKAAIKQGNEATAIFKAASEEDSKDKEEAES-DLTYNYVISNKAYNEFKLDVALDSLKKVEENKNKELMKEDITSLKEEISKDKSVLDDFYSSMEKVNDLESEGKISEARDLLNKSLKNI.......... 152
27 -10.600IDP05677 hypothetical protein lmo1068 [Listeria monocytogenes EGD-e] lmo1068 [Listeria monocytogenes EGD-e]  ali follow..  13  1MKKWMVIISIISLVALLGACG--------NNDNEKDQEDKSTTDSTTKKAKSSSNESNKAAETKENDTNDKAATTDKGSSNPTKEEKDTSTTTDTPKKETPKSPAKTEAFSFSPSGFKVSTVESILGGDVTTTYLSS......................................................... 129
28 -10.500IDP05486 putative lipoprotein [Bacillus anthracis str. Ames] BA_4573 [Bacillus anthracis str. Ames]  ali follow..  13  1MRAFFRIGPFLIVVLLLVGCQSEENKIEQKATTTKAEEKVQITKEEEKSIQDVMDKFVRTTNEKNLAEHIEKTQKEAAFQKGNKKIELEHIDIKASKAGYVVVETKEKEIDGEITLQKKVQYAIGKEEDGWKIEEVRTIEKK.................................................... 155
29 -10.500IDP05670 hypothetical protein lmo0617 [Listeria monocytogenes EGD-e] lmo0617 [Listeria monocytogenes EGD-e]  ali follow..  12  4LKSILLLMGIITFALALTACGGTEDKASTEKIETAKAETKKKSNPNELGDYKVE-------ILSSEVVKDFEGNNAIAIKTKFTNNSKENISFMVAIDQQAFQNGTQLETTVSAD-------ASMGGSEKDVQPGGTLEVTELYKLQDT............................................. 138
30 -10.400IDP05417 conserved domain protein [Bacillus anthracis str. Ames] BA_4788 [Bacillus anthracis str. Ames]  ali follow..  13  1MFKQFKMIIAVFAVLFTFIATLGLQDAKAATKLADGKYNIAFTVWKGDKDE---SSRMNRYFESPATLTVKNGKQYVSFKVKDSTS--KSFQVEKDGQFVETTVLSENKKDNTRVVEFEVA......................................................................... 117
31 -10.400IDP05485 putative lipoprotein [Bacillus anthracis str. Ames] BA_3234 [Bacillus anthracis str. Ames]  ali follow..  11  3MKGNVSVVFIAIVIFIIAGCSNMIGNEDQTIKVQKHVDD-LKVVTDNKQVQQVKKILNDAHFENKKVQMSRPADYHFVFQFKNPKIEAKATLYQIWVIPNKDKIEIIAGNSQYVQLEGKNAATLFQIITGEKLVE........................................................... 141
32 -10.200IDP05125 putative lipoprotein [Bacillus anthracis str. Ames] BA_4310 [Bacillus anthracis str. Ames]  ali follow..  10  1MKKLI--MTLFIAMLALAGCNTNKEEPKKEQKLEA--EKTEVQALVTQGKEKVTDAVEKTFETDGVYHIIVMPEVKVAVGNAKVEDAKKENSDHGAGHGDHKSDTMIHLMAGDIKANAESTMKVHLKQKEEALTGAEVQLEIWKDGVEKHEFIPAKEGNKGEYETKHTFKENGSYKVKVHVKKG.......... 233
33 -10.200IDP05009 putative lipoprotein [Bacillus anthracis str. Ames] BA_4237 [Bacillus anthracis str. Ames]  ali follow..  10  1MKAWKSIFVLCSFLLMLSGCF-----HQEEKKVEPKKKESIPETKEYGGRELKKVGQKVKETGWGTFKLEQIHSVNQTFEVAPMKIHVQDVKVISLSQMSKLYASLSGTEISDTIRYVEITYKVENSGNKNM.............................................................. 158
34 -9.760IDP05763 hypothetical protein lmo2331 [Listeria monocytogenes EGD-e] lmo2331 [Listeria monocytogenes EGD-e]  ali follow..  15  1MKKGIALLAMLAFSIFLTGCG-----GTDNTRKENHSDGSAEVKNKKDNNTSDEYVEDGLLLKVGEWTKDKDYDTKVTLELNMLIKDVKIFKRENVSDAEKEEFSGGKVPVTDPYYTIQVKYDLENTGKNVL.............................................................. 142
35 -9.700IDP02585 lipoprotein [Francisella tularensis subsp. tularensis SCHU S4] FTT1416c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  4LKAKIYIIFLAAVLAVISGCATDKGTQYKDGYYITTLNY-NFNTVYNATLQAIQNGQTFDYKSNPYDISVNKNNGDAEIVSASDSDSTDSLQVAMKKLPNNATRIS-GNSIRSSALIGIIEGNIRYANT................................................................. 137
36 -9.650IDP04197 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_2510 [Clostridium perfringens ATCC 13124]  ali follow..  10  1MKKLVPVLVIIIFALLFVGCTNSSNSSSDSSVEIIN---------SNQQNSNSNNNNSSNNDTKKSDSNNASHKDNKDNNVSNNKNTNKKLDNKAEKLLKDIKEKAVKGEIIDYDFKLGDSIYDVIDKLGKPSSENYVAEAKGNYFNFDSYNLSFGCNKGDQIFEIRSLNKDLKSLDLNNVENFF......... 177
37 -9.640IDP91956 ABC transporter, substrate-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100005733 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  11  1MFKNFKKIAFTSSLILLAACSNNASNTNQSTDEGSVDKSQEIVIYTNSASN-GRADWLQTKASEQGYNLRLVDISGGELADRLIAEKNNAMVIGLNKLEFNRIKAEKLLVKYSPKWADEVDSSLGDSEG--LIGNKDAKMPSDW----TDFTDSSYKGKYGISKLSTGTSKNIFASIVSRYKDE.......... 191
38 -9.630IDP06193 gene: lpp20; lipoprotein [Helicobacter pylori J99] NP_224067 [Helicobacter pylori J99]  ali follow..  1MKNQKILGMSVVAAMVIVGCS----------------APKSGISKSNKAYKEATKGAPDWVVGDLEKVAKYEKYSGVFL----------GRAEDLITNNDVDYSTNQATAKARANLAANLKSTLQKDLENEKTRTVDASGKRSISGTDTEKISQLVDKELIASKMLARYVGKVLVGLDKQIVDKVREELGM... 172
39 -9.550IDP02402 hypothetical protein FTT1778c [Francisella tularensis subsp. tularensis SCHU S4] FTT1778c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  10  3LRKVLIATLLGASALSLSSCWLLVGAAVGGGTAAYISGEYSMNM--SGSVKDIYNATLKAVQSNDDFVITKKSI----------TSVDAVVDGSIKVDSTSFYVKIEKLTDNASKVTIKFGT-FGDQAMSATLMDQ.......................................................... 125
40 -9.510IDP05029 putative lipoprotein [Bacillus anthracis str. Ames] BA_0864 [Bacillus anthracis str. Ames]  ali follow..  12  1MKKYTLYSLMLLTLLFLSACSNSAQPKEENDVQSIKDVTVKIPE-ETINEDEMKRSIKTYLDYSGELYENTVPLSSAMSDEKVTESDREKLDLAQQNDANFHHFISNNTIPHDYK............................................................................... 127
41 -9.500IDP92720 hypothetical lipoprotein [Francisella tularensis subsp. tularensis SCHU S4] FTT0289c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  13  1MKKIKLLAAYTLATLTLVSCSNNASLSNDLNSAGDSVNGTFYAEIYNTSLQSVYNATLLALNNSNIYSVKNNTINSKDAEITGTYATDKNFFNKSGQDDFAIRLVKGNQDTINLFIKIGK-----DKQASVDLLAK.......................................................... 137
42 -9.360IDP91955 ABC transporter substrate-binding protein - iron transport [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100006939 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  10  1MKNKFFLIAILAMCIVFSACSSNSVKNEENTSKEHAPDKIVLDHAFGQTILD---------KKPERVATIAWGNHDVALALGIVPVGFSKANYGVSADKELNGKANLFDDLDGLNFE-----AISNSKPDVILAGYSGITKEDYDTLSKIAPVAAYKSKPWQTLWRDMIKIDSKALGMEKEGDELIKNTEARI. 190
43 -9.220IDP05454 putative lipoprotein [Bacillus anthracis str. Ames] BA_0190 [Bacillus anthracis str. Ames]  ali follow..  10  1MRTLLSVLLALMLVPALTGCK-EEAKNETPADLKLNFNEFSLDADYQDTKKDYEKKMEAKIEDHKADVNLTGDEAITKLSPLLQELK---FDKGTPDQEVIDQVLNVFKLDKDYQ-KFELEVVFSDGTKKEYKREIK......................................................... 155
44 -9.160IDP05001 putative lipoprotein [Bacillus anthracis str. Ames] BA_1090 [Bacillus anthracis str. Ames]  ali follow..  11  1MKRVMYVVLLLSFVIGMTACNDETSSSRTLLSIGKPAKIYFTHTDNKRKIQEIQDMFQNKKWKRNETFSTVNKTPDVVFS.................................................................................................................. 83
45 -9.120IDP05698 hypothetical protein lmo2186 [Listeria monocytogenes EGD-e] lmo2186 [Listeria monocytogenes EGD-e]  ali follow..  10  1MKKVLVFAAFIVLFSFSFL----STGLTAQAALKDGTYSVDYTVIQGDSDS---ASMANDYFDKPATVTVNGGKSTVSLQVNHSKW--TGLWVEGNAVSVTSKNASSDTRKVSFPVSVNAKIKV-DIDDDDLNYHHEYQIKLRFDEGSAKALAGAVKSSDNNTTTPATKSDSSNKVTNPKSSDS.......... 180
46 -9.110IDP05445 hypothetical protein lmo0821 [Listeria monocytogenes EGD-e] lmo0821 [Listeria monocytogenes EGD-e]  ali follow..  12  1.MKKIIFTVVLSLVLVLAGC-VTNTVKVDKKGEATISFDIDISSVAGIFASSYSDEVEAKLKEAG-FTVDKKSNTSYHIEKKVDKNETTKSDMKPEKEVADVPFPKEILSQVDYTFILDLPISSIGENNAKSVDGGKLT....................................................... 168
47 -9.090IDP95182 hypothetical protein KPN_03558 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337220 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  1.MKALSPLAILLSALLLQGCV--VGTAAVGTKAATDPRTVGTQVDDSTLELRVNSALSKDEQIKKQARIVTAYQGKVLLTGQSPTPDLSARAKQIAMGVEGTTEVFN-------EVRQGQPIGLGTASSDTWITTKRSQLLSTDQVKSSNVKVTTENSEVFLMGLVTDREGRAAADIASRVVSRVTTAF..... 187
48 -9.020IDP05476 putative lipoprotein [Bacillus anthracis str. Ames] BA_2745 [Bacillus anthracis str. Ames]  ali follow..  11  1MKKSTLILCSLCLGFSMTACEQKKEVKKQTATSSTVMENQKKESININHFSNINEGMTYK...................................................................................................................................... 60

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.