current user: public

If you have questions about the server, please let us know.

Query: IDP90350 hypothetical protein CT456 [Chlamydia trachomatis D/UW-3/CX] CT456 [Chlamydia trachomatis D/UW-3/CX], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930    .  940    .  950    .  960    .  970    .  980    .  990    . 1000    .
# Score Template Links and tools%idFirst MTNSISGYQPTVTTSTSSTTSASGASGSLGASSVSTTANATVTQTANATNSAATSSIQTTGETVVNYTNSASAPNVTVSTSSSSTQATATSNKTSQAVAGKITSPDTSESSETSSTSSSDHIPSDYDDVGSNSGDISNNYDDVGSNNGDISSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSDGAAAAALNSLRGSSYTTGPRNEGVFGPGPEGLPDMSLPSYDPTNKTSLLTFLSNPHVKSKMLENSGHFVFIDTDRSSFILVPNGNWDQVCSIKVQNGKTKEDLDIKDLENMCAKFCTGFSKFSGDWDSLVEPMVSAKAGVASGGNLPNTVIINNKFKTCVAYGPWNSQEASSGYTPSAWRRGHRVDFGGIFEKANDFNKINWGTQAGPSSEDDGISFSNETPGAGPAAAPSPTPSSIPIINVNVNVGGTNVNIGDTNVNTTNTTPTTQSTDASTDTSDIDDINTNNQTDDINTTDKDSDGAGGVNGDISETESSSGDDSGSVSSSESDKNASVGNDGPAMKDILSAVRKHLDVVYPGENGGSTEGPLPANQTLGDVISDVENKGSAQDTKLSGNTGAGDDDPTTTAAVGNGAEEITLSDTDSGIGDDVSDTASSSGDESGGVSSPSSESNKNTAVGNDGPSGLDILAAVRKHLDKVYPGDNGGSTEGPLQANQTLGDIVQDMETTGTSQETVVSPWKGSTSSTESAGGSGSVQTLLPSPPPTPSTTTLRTGTGATTTSLMMGGPIKADIITTGGGGRIPGGGTLEKLLPRIRAHLDISFDAQGDLVSTEEPQLGSIVNKFRQETGSRGILAFVESAPGKPGSAQVLTGTGGDKGNLFQAAAAVTQALGNVAGKVNLAIQGQKLSSLVNDDGKGSVGRDLFQAAAQTTQVLSALIDTVGLast
1 -169.000IDP90350 hypothetical protein CT456 [Chlamydia trachomatis D/UW-3/CX] CT456 [Chlamydia trachomatis D/UW-3/CX]  ali  100  1MTNSISGYQPTVTTSTSSTTSASGASGSLGASSVSTTANATVTQTANATNSAATSSIQTTGETVVNYTNSASAPNVTVSTSSSSTQATATSNKTSQAVAGKITSPDTSESSETSSTSSSDHIPSDYDDVGSNSGDISNNYDDVGSNNGDISSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSDGAAAAALNSLRGSSYTTGPRNEGVFGPGPEGLPDMSLPSYDPTNKTSLLTFLSNPHVKSKMLENSGHFVFIDTDRSSFILVPNGNWDQVCSIKVQNGKTKEDLDIKDLENMCAKFCTGFSKFSGDWDSLVEPMVSAKAGVASGGNLPNTVIINNKFKTCVAYGPWNSQEASSGYTPSAWRRGHRVDFGGIFEKANDFNKINWGTQAGPSSEDDGISFSNETPGAGPAAAPSPTPSSIPIINVNVNVGGTNVNIGDTNVNTTNTTPTTQSTDASTDTSDIDDINTNNQTDDINTTDKDSDGAGGVNGDISETESSSGDDSGSVSSSESDKNASVGNDGPAMKDILSAVRKHLDVVYPGENGGSTEGPLPANQTLGDVISDVENKGSAQDTKLSGNTGAGDDDPTTTAAVGNGAEEITLSDTDSGIGDDVSDTASSSGDESGGVSSPSSESNKNTAVGNDGPSGLDILAAVRKHLDKVYPGDNGGSTEGPLQANQTLGDIVQDMETTGTSQETVVSPWKGSTSSTESAGGSGSVQTLLPSPPPTPSTTTLRTGTGATTTSLMMGGPIKADIITTGGGGRIPGGGTLEKLLPRIRAHLDISFDAQGDLVSTEEPQLGSIVNKFRQETGSRGILAFVESAPGKPGSAQVLTGTGGDKGNLFQAAAAVTQALGNVAGKVNLAIQGQKLSSLVNDDGKGSVGRDLFQAAAQTTQVLSALIDTVG 1005
2 -29.600IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali follow..  1538.EKKEKKEKKKKKGGETAAEPEEASAVLAPPPVPVPAAAIPSVLLPADSEDGEKEQPKEKKKEKKEKKKKKDGETDAEPEEASAVLAPPPVPVPAAAIPSILLPTDGEDGEKEKTKEKKTEKKKEKHTEKKHKKKSEALPESETTAVVTVTPGEEDETSPLVPVPSSIASSEAPEPPASTRVTPAPEPKAKPGLSMGAALLAVRARSRLQRKHLAQQLSSSSSSEVSASSASSLSPSSSSSSDFAETRAKADALRARLQAAQARLAAARETEVSSSETESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMVSGVKAAYRRLEEENTRLAATRRRDDKLQRQVEAER---------------------RAVELLKEATRRAKE---------------------EKDLIARQPPPARDWS------------------DTVVLSTPQIFVNSQAACAPFA------------------------DSGRDEGGRDEWYEVSDACSRRAESSNESRTTAGAKLRQQQLDLAGRT.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1990
3 -20.000IDP92738 gene: hsa; streptococcal hemagglutinin [Streptococcus gordonii] BAA97453 [Streptococcus gordonii]  ali follow..  1MFFKRQKGQYHEVERVTRFKLIKSGKHWLRAATSQFGLLRLMKGADISSVEVKVAEEQSVEKGGLNYLKGIIATGAVLGGAVVTSSSVYAEEEQALEKVIDTRDVLATRGEAVLSEEAATTLSSEGANPVESLSDTLSASESASANSVSTSISISESFSVSASASLSSSSSLSQSSSESASASESLSVSASTSQSFSSTTSSTQSSNNESLISSDSSNSLNTNQSVSARNQNARVRTRRAVAANDTEAPQVKSGDYVVYRGESFEYYAEITDNSGQVNRVVIRNVEGGANSTYLSPNWVKYSTENLGRPGNATVQNPLRTRIFGEVPLNEIVNE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 334
4 -18.600IDP92737 platelet-binding glycoprotein [Streptococcus sanguinis SK36] YP_001034807 [Streptococcus sanguinis SK36]  ali follow..  1MFFKRQKGKYHEVERVTRFKLIKSGKHWLRAATSQFGLFRSMKGGGLSSIELKVTEEQVTDKKSGIDFLRGIVATGAVLGGAVVTSTTVHAEEGQALEKVIDTTDVLATRGETVLGEESSAAEAATATASSHTESESVSDTSSASASASVSASISASISASESMSQFSSASISASTSQAVSDSLSVSESLSVSSSTSDSVSASQPASTSASSKSESTVNSQSASSETNRSSTNNGSTSSSSETARVRKRRATDTTPPTITVPSDIIAYRGEEFEFYFEITDDSGQVKNIELSTFGKPLGLNWLEYSEDNFNVPGNATSDNPLRVRVHGTVPLNE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 334
5 -17.200IDP06528 gene: scm; collagen-binding MSCRAMM Scm (Fms10) [Enterococcus faecium DO] AFK60297 [Enterococcus faecium DO]  ali follow..  12  258.SNHETEDFSDANISWNFGNEMTDLTISAPFQGTILAPNATIRITQNQDGTIIGTNVILDAATNRWDPNEIFISDNGTDTTDTSDSTDTSTTSDSSDSSTSSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTSTTTSDSTDTSASSDSTDTTSTTSDSSDSSTTTSDSTDTSASSDSTDTSSTTSDSSDSSTSSDSTDTSSTTSDTRHASVSFSKTSSDNRTNFNLTNKTSNDNGNKSKRALPKTGSQSNNWITLAGVILLVIGLRITFMSYKKSKR.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 603
6 -17.000IDP91949 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007099 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  694.............................SYDGTFTVPTSLAYKMASQTIFYPFHAGDTYLRVNPQFAVPKGTDALVRVFDEFHGNAYLENNYKVGEIKLPIPKLNQGTTRTAGNKIPVTFMANAYLDNQSTYIVEVPILEKENQTDKPSILPQFKRNKAQENSKLDEKVEEPKTSEKVEKEKLSETGNSTSNSTLEEVPTVDPVQEKVAKFAESYGMKLENVLFNMDGTIELYLPSGEVIKKNMADFTGEAPQGNGENKPSENGKVSTGTVENQPTENKPADSLPEAPNEKPVKPENSTDNGMLNPEGNVGSDPMLDPALEEAPAVDPVQEKL-----EKFTASYGLGLDS---------------------DGTIELRLPSGEVKKNL--SDL---IA............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 1039
7 -16.800IDP92613 RecName: Full=Serine-rich adhesin for platelets; AltName: Full=Staphylococcus aureus surface protein A; Flags: Precursor SAOUHSC_02990 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  12  8FHDSLANEKTRVRLYKSGKNWVKSGIKEIEMFKIMGLPFISHSLVSQDNQSISKKMTGYGLKTTAVIGGAFTVNMLHDQQAFAASDAPLTSELNTQSETVGNQNSTTIEASTSTADSTSVTKNSSSVQTSNSDTVSSEKSEKVTSTTNSTSNQQEKLTSTSESTSSKNTTSSSDTKSVASTSSTEQPINTSTNQSTASNNTSQSTTPSSVNLNKTSTTSTSTAPVKLRTFSRLAMSTFASAATTTAVTANTITVNKDNLKQYMTTSGNATYDQSTGIVTLTQDAYSQKGAITLGTRIDSNKSFHFSGK......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 315
8 -15.800IDP06537 Surface protein from Gram-positive cocci, anchor region [Enterococcus faecium DO] EAN08832 [Enterococcus faecium DO]  ali follow..  13  327.IFISDNGTDTTDTSDSTDTSTTSDSSDSSTSSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTSTTTSDSTDTSASSDSTDTTSTTSDSSDSSTTTSDSTDTSASSDSTDTSSTTSDSSDSSTSSDSTDTSSTTSDTRHASVSFSKTSSDNRTNFNLTNKTSNDNGNKSKRALPKTGSQSNNWITLAGVILLVIGLRITFMSYKKSK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 659
9 -14.300IDP06012 membrane-attack complex / perforin domain-containing protein [Toxoplasma gondii ME49] EEB00555 [Toxoplasma gondii ME49]  ali follow..  12  2LLSAIGGIGPTESRLQHIPFSTTRYLPIRSHVLQSTVERIESPEALNEVPTKVERNEFTEKGDKTEQVLTAQADHKSLLEGRSVRLESTSTAPDDDFDFLFEDDTPKKPKSRVNKGTSSDETSPGDRSSGEGSSDSDSLLSVVHRTKGNATQANKNQTRITHPKSKAQHQKKVTKKQGIPGSDSLGTSSADFDFDIDSSSNTQADDSQRQSLGDSSALDLFGSDTGDTGDIFGFSNSSSDGGNAAANDGGLFSSSGMGPTGASDETSANPLGSILG......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 277
10 -12.800IDP92612 gene: gbs1529; Unknown [Streptococcus agalactiae NEM316] CAD47188 [Streptococcus agalactiae NEM316]  ali follow..  11  567.SQYSYTNDGSKITIDWKTNSISSTTSYVVLVKIPKQSGVLYSTVSDINQTYGSKYSYGHTNISGDSDANAEIKLLSESASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMSASMSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTSASTSASTSASMSAS.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 878
11 -12.200IDP92687 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus str. Newman] YP_001331559 [Staphylococcus aureus subsp. aureus str. Newman]  ali follow..  46.....GNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDGKDNVAAAHDGKD................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 308
12 -11.900IDP91673 CD44_HUMAN [Homo sapiens]  ali follow..  12  307.TISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPREDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSTTLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSAVNSRRRCGQKKKLVINSGN---VEDRKPSGL---NGEASKSEMVHLVN---KESSETPD------------QFMTADETRNLQ--VDMKIGV.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 742
13 -11.800IDP91504 putative translocation protein in type III secretion [Vibrio parahaemolyticus RIMD 2210633] VP1670 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  1MRIKPSTDTPSTQPHSPQSPMPIDDHAMLQSRFERALKENPDQTKPQPNETNNQAALEAKKPFTENYSERSLASLHSTGSNQRKTAEKSAFAQNNDVVTENINNESDTSSPIALNTQDKMPSDMDANMKPDIRIPTTGDKKLPMEPSNKREKNADEQDAFERLVEDHDDSKTELAAAKTAESHESTQSPKDTKHIPTAGTKPNTVETVSDALASTLASTTVASATSASLASHPVTSTVHKTATKTEVNKHEGDSSLGFNSRNLKTPIPNDEHPKASQAERTLLDRAMLDSEKSNDKPMHQPVTTPIT.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 307
14 -11.600IDP91728 gene: BIN1; myc box-dependent-interacting protein 1 isoform 1 [Homo sapiens] NP_647593 [Homo sapiens]  ali follow..  11  268.................................................................VGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHD------------TATDTDELQLKAGDVVLVIPFQNP----QDEGW------------------------------MGV--KESDWNQ--HKELEKCRG-----------VFPENFTERV---P.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 593
15 -11.500IDP92699 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus USA300_TCH1516] YP_001574462 [Staphylococcus aureus subsp. aureus USA300_TCH1516]  ali follow..  46.....GNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDGKDNVAAAHDGKDIEYDTEFTIDNK..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 320
16 -11.500IDP06534 Surface protein from Gram-positive cocci, anchor region [Enterococcus faecium DO] EAN10892 [Enterococcus faecium DO]  ali follow..  12LGLSIIAAMIGISTSANERANENLSFTVKTDRIVYDMTQQVITIPVKPNKSVNASDVHAVLTYGWDGNGSSEKVIGEVYLKDVQWTAGIEYTIMISAELSIDEIKSKDKVDLIVFYDGQMTITENLKPSSWTVVGPPSSTDSTSSESSTENTSGESSTESTSSESSTENTSSESSTESTSSESSTGSTSSESSTESTSSESSTGSMSSESSTGSTSSESSTGKVNNELDLVPIIPTKEQKRNAGSNLKSVLKQPDFVSRGIDHQEKAKETDNRKSDLPETGSRTLNKLITWMG........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 304
17 -11.000IDP91679 gene: vIRF-3; vIRF-3 [Human herpesvirus 8] HHV8GK18_gp64 [Human herpesvirus 8]  ali follow..  139..................................................................QHSVRLEKHRRRPRPFVGENSDSSEEDHPAFCDVPVTQTGAESEDSGDEGPSTRHSASGVQPVDDANADSPGSGDEGPSTRHSDSQPPPADETTVHTDNVEDDLTLLDKESACALMYHVGQEMDMLMRAMCDEDLFDLLGIPEDVIATSQPGGDTDASGVVTEGSIAASAVGAGVEDVYLAGALEAQNVAGEYVLEISDEEVDDGAGLPPASRRRPVVGEFLWDDGPRRHERPTTRRIRHRKLRSAYYRVARPPVMI.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 395
18 -10.900IDP92610 gene: srr-2; serine-rich repeat protein [Streptococcus agalactiae] AAZ95526 [Streptococcus agalactiae]  ali follow..  15  802.ESISSSESVSNSESISTSESVSTSESISSSESVSNSESISSSESVSNSESISSSESVSNSESISSSESVSNSESISSSESVSSSESVSSSESISTSESVSNSESISSSESVSNSESISSSESVSNSESISSSESVSNSESISSSESVSSSESISSSESVSSSESVSNSESISSSESVSNSESISSSESVSSSESISSSESVSNSESILSSESVSSSESISSSESISSSESVSMSTTESLSESEVSGDSEISSSTESSSQSESMNHTEIKSDSESQHEVKHQVLPETGDNSASALGLLGAGLLLGATKSRKKKK................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1114
19 -10.800IDP90339 hypothetical protein CT050 [Chlamydia trachomatis D/UW-3/CX] CT050 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  196.DTKSAINVEFVQAKITSPQMAFLKNNDTNLSNITVSEYFNWLQDPTQAPTPEPDPDPEPAPEPEPDTSDSSGSGSENPADPAPTNPSDSNAQNNPTPSSNGATASIRKLAATTTTVPTDTEIAPAAEDPNLPNTTFSEKSPLWEEFFSFSDSSRSEMVIQKTGILTFSMQGTWENPSSSQTPSTDPISLELTVTPPTTDTPPESPPSPPEAPAPEATPSPTNNNLTASITKTFSRKYNLSATPSPTPTTPTEPTTITKTLSLSSGQSCTLQIPVQATRSVLKLKYVNPNNNSSGGSSGSGGSSQPETTPTGITLQSFSWSLVLTPGEITKATSTPSTPSQP....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 536
20 -10.700IDP90291 high mobility group (HMG) box domain-containing protein [Toxoplasma gondii ME49] TGME49_081900 [Toxoplasma gondii ME49]  ali follow..  27LKQGAEAGGAVKLTGNPSEQSSEDGSHHCSSNFQNSPVTSDLSVLDASPCGLPAEKRKPPHRETSISSNASQSEREIAPTATRRLSPKPETATLSPSESSSLTAATLSNCSSRVQSSSDEKIGNCPSTSACSVSQTTASSEAPSWLSSGASTAQVLSERRGSIEEQPAPETSAAAVRVSRSSSDSENLFASCSASLRNLEPDDISDPENEAAAPACAETGASRAQDAAAVRADAENLGEGESHMETASTRAESLAKDAISSKVSRRGSAHTSSDASGQCQDALPSVGEGKPGEMNGREEDGEAEKPEAS........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 335
21 -10.700IDP90426 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_863 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  11  1MDTPTPLSSVPTNASLKGEPGSSSQFSSAEKGVLKTSVGDVVLSQSIEDGGNETQISLVGVVNINMAQEELPTLVSPRTFIFLPPETVELEIQIAEQALEETPSSDSRSLQQKETSAQTPPAPSGKVSIFSLQAQGSSQTRSLPSSQESLSPQQPARAIQGLNTPFSPAARCTIRAVPLSIVPHRRANPTSSQSVSHHSSRTYQTGHSTGTAQLSSQEWEFSSQTVKTCSTGREKRDGQQERHSDQEQNSDHSYQEEDLSDDMQVSSSKRSSHPEDENTEEVFSVSHFAYHAAPHPSSNLDQESNQSTFQKRPPSPMSLFSSQNATEEAPKEARV----RTDNVDSKINNEKGAI--VDQAKKLGVPIGD-DWSE-ENIQM-----KENMEITQLE-------------RTDMQRHLQ-EVSARS---------NVLKLLKELMDTFIYNP.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 482
22 -10.500IDP06413 gene: vIRF-2; vIRF-2 [Human herpesvirus 8] YP_001129414 [Human herpesvirus 8]  ali follow..  124......YLTQEPAMKNMLKALFGIYPHDDKHREKALRRSLRKKAQREAARKQAAAVATPTTSSAAEVSSRSQSEDTESSDSENELWVGAQGFVGRDMHSLFFEEPEPSGFGSSGQSSSLLAPDSPRPSTSQVQGPLHHTPTDLCLPTGGLPSPVIFPHETQGLLAPPAGQSQTPFSPEGPVPSHVSGLDDCLPMVDHIEGCLLDLLSDVGQELPDLGDLGELLCETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSGQELPDLGDLSELLCETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSSFQASDNVDDFIDCIPPLCRDDRDV............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 468
23 -10.000IDP06029 adaptin N terminal region domain-containing protein [Toxoplasma gondii ME49] EEB01203 [Toxoplasma gondii ME49]  ali follow..  801.........DRSYDVRDMAQLYFTLSQLALSTESTEERQESSEGKIKREDMAGEQISADGTHGFHQPEAVDLSFNDLSGFGGDALKPGTPLRGMQKFASTYMRFLAAAPGVEIQKRTEGQSLDTKTGPAAPGLTCCHVLQNGDGEREADHAVGPDVIEDSHGPAFVLGSLSDHMAERMLGYVSLPPFAEENSSEQLRYVETEERRALVVGPSGGLGRTAGGLSPHKELKSISSDDVVVKRNAAALMGREAVAKAALTPLDLDSFYSDLCGGSGNSSSGVDTASAPAGQQDCGEATGHHTRAEQGDARGKTSLWQMFGNAEELGNDAEVEARDTAIQSGTHTGAVGVKSATCCEGVAVAGEDDES---------DEDREWRAAAVGEKEDICDGSCDNDSSR---GDDR-EGDW--KFMP--AAR..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1202
24 -10.000IDP00762 staphylocoagulase precursor SACOL0209 [Staphylococcus aureus subsp. aureus COL]  ali follow..  10  307.KKYGETETKSPVVKEEKKVEEPQAPKVDNQQEVKTTAGKAEETTQPVAQPLVKIPQGTITGEIVKGPEYPTMENKTVQGEIVQGPDFLTMEQSGPSLSNNYTNPPLTNPILEGLEGSSSKLEIKPQGTESTLKGTQGESSDIEVKPQATETTEASQYGPRPQFNKTPKYVKYRDAGTGIREYNDGTFGYEARPRFNKPSETNAYNVTTHANGQVSYGARPTYKKPSETNAYNVTTHANGQVSYGARPTQNKPSKTNAYNVTTHGNGQVSYGARPTQNKPSKTNAYNVTTHANGQVSYGARPTYKKPSKTNAYNVTTHADGTATYGPRVT................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 635
25 -9.860CPX_91702_91677 Complex of EZRI_HUMAN with M1_I34A1 [Undefined organism]  ali follow..  10  425.TAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEALXMSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKA-----MEQMAGSS--------QAAEAMEVAS-QARQMVQ--------AMRTIGTHPSSSDLLENLQA--QKRMG-----------VQMQRFK................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 839
26 -9.720IDP91181 wall surface anchor family protein [Chlamydophila felis Fe/C-56] CT578 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  10  3LSSSSSSDSSNLKNVLSQVIASTPQGVPNADKLTDNQVKQVQQTRQNRDDLSMESDVAVAGTAGKDRAASASQIEGQELIEQQGLAAGKETASADATSLTQSASKGASSQQCIEDTSKSLELSSLSSLSSVDATHLQEIQSIVSSAMGATNELSLTNLETPGLPKPSTTPRQEVMEISLALAKAITALGESTQAALENFQSTQSQSANMNK---MSLESQGLKIDKEREEFKKMQEIQQKSGTNSTMDTVNKVMIGVTVAITVISVVSALFTCGLGLIGTAAAGATAAAAGATAAATTATSVATTV........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 305
27 -9.630IDP91522 conserved hypothetical protein [Toxoplasma gondii GT1] TGGT1_033230 [Toxoplasma gondii GT1]  ali follow..  5...............................................................................TSGKALPPGVDATTISSPAQGRCNVVPGAGQRTHLASQATSAFVQAAISVDQQRGSKQMVAQCLTQSTHVREMASHLGGRPTHFNQVVDQQYTSTCTTTGCTSGTYLHPPSSTALRGLTDSTEKPLPGTPQLYSPSHPGKAVQQLERLMRPCATAHSLPVPPTGAPVTVSGSALPSTTVPAGGVPGTQQGEEGVPSEVADSFFPGSDLQSRAMLKAKPGVPAETVARPSADIASGPVQSPAPAPALPTPPENTLIILDYDDTPTN-AELSELCIQTINICLARGMVVIVTNATW-QTQGIEIISARD........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 351
28 -9.600CPX_91720_91682 Complex of TF65_HUMAN with O41974_MHV68 [Undefined organism]  ali follow..  370.SGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISSXMPTSPPTTRNTTSGKTRSGCKRRCFNKPAAMPPKRRRAPKRPAPPPPPGCQGDEESSQGTQTPNPPSPPVPPSSPTLPSSPVPPSSPVHEPPSPSPPPAPPSPDVDVEGLDVGETDDPGPPPPKRYSRYQKPHNPSDPL--PKKYQGMRRHLQVTAPRLFDPEGHPP--HFKSAVMFSSTHPYTLNKLHKCIQSKHVLSTPVS-PLVPGTTQQCVTYYLLSF--VEDKKQAKKLKRVVEKYHSS------EGTIVKAK-----PYFPLPEPPTEPPTDPEQPSTSTQA-SGTQHGDAGAEQGATGSPGSSPGQQGQGSQ...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 865
29 -9.570IDP93878 serine rich protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007690 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  310.YDLETPSVNSNNAAQPGSVINNIKNITTTNNYYYGTPASIPNNISNTSGSDVTTQPEDNKPQSATATQTAVDTTDSSDQVSDEIDNSAQPKPLFVSSTALEPPVVKQDEPANYITTLDIQVNADETSPPADGLYRTVSAKVVAERHLNAQGSLLGTSGPIQSSITAAPKVTLTRGGQVRDLSQKQNDERGGSQQKSPSSVNTQGTSFAGLGENTSELLLAKSFLANKDAAVTLTQKGAQTRDLSQQSTYRLGGTQQKGPSSLTAQGNQFVGFGKNASVPTQSWSGNKDSNVTLTQKGAQTRDLSQKEDYRKSDTNAVNTGRSQLNKQPTE.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 639
30 -9.440IDP91542 3`,5`-cyclic phosphodiesterase, putative [Toxoplasma gondii ME49] TGME49_080410 [Toxoplasma gondii ME49]  ali follow..  1MAAESSPSGPIESAGLAARDESPTRSSTSSLDPDQQT--EHASSLPSLRESPRASASSSGVASKAGEGPRLLTFLPQRLHEATPPQDGALPAASGHGHTDAETHAQGANPGEARPEIQAGPDSDSKTSSSPLSFLTSLAVASKQKAHAEGVSSHASSISGKRRAQGVEKLSVGSSKTALVSLDEESDVSGADSAASVLSSQWASGEDRTIGAKPVPDRARWTTTAHDATTHGDASAETLTTPEGIQSPPLSCIVAVEEQTVPPWEERGIVEGVGVVKASSLKKSGRGPKAIHFREADSEVSAPSFSDMPSLGPGMGRQESDLERRSNGEVFRPMHFSEDDEEEDEEETKRYLGRSQTGDPGWRGLRWQMRSMWRYVAAINNDEATMKNATGPCDCKCFPLAF----RRAECDYRNFNIRRMPLR..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 427
31 -9.410IDP06395 gene: ORF50; ORF50 [Human herpesvirus 8] YP_001129401 [Human herpesvirus 8]  ali follow..  327..QAASQNMVYNTSTAPLKPATGSSQTVSVKAVAQGAVITATTVPQAMPARGTGGELPVMSASTPARDQVAACFVAENTGDSPDNPSSFLTSCHPCDPNTVIVAQQFQPPQCVTLLQVTCAPSSTPPPDSTVRAPVVQLPTVVPLPASAFLPALAQPEASGEELPGGHDGDQGVPCRDSTAAATAAEATTPKRKQRSKERSSKKRKALTVPEADTTPSTTTPGTSLGSITTPQDVHATDVATSEGPSEAQPPLLSLPPPLDVDQSLFALLDEAGPETWDVGSPLSPTDDALLSSILQGLYQLDTPPPLRSPSPASFGPESPADIPSPSGGEYTQLQPVRATSATPANEVQESGTLYQLHQWRNYF................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 689
32 -9.340IDP00768 superantigen-like protein SACOL0470 [Staphylococcus aureus subsp. aureus COL]  ali follow..  3MRTIAKTSLALGLLTTGAITVTTQSVKAEKIQSTKVDKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAPNTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQAQTDMTPKYED..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 170
33 -9.150IDP91038 hypothetical protein SAHV_2481 [Staphylococcus aureus subsp. aureus Mu3] SAHV_2481 [Staphylococcus aureus subsp. aureus Mu3]  ali follow..  44.....TQQEAEAAENNIENPTTLKDNVQSKEVKIEEVTNKDTAPQGVEAKSEVTSNKDTIEHEASVKAEDISKKEDTPKEVANVAEVQPKSSVTHNAEAPKVRKARSVDEGSFDITRDSKNVVESTPITIQGKEHFEGYGSVDIQKNPTDLGVSEVTRFNVGNESNGLIGALQLKNK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 215

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.