current user: public

If you have questions about the server, please let us know.

Query: IDP90373 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_191 [Chlamydia trachomatis D/UW-3/CX], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MSFYPQNLPSFRRRKPSRTDSPIKHAKHFLRDHLSHLRKILAGKPQEVIEAWYEILGKKYNGMTQAIGLKDGILSIKVRNASLYAVLKQSSQKELISRIHSAVPGAKVKEIRFLLGLast
1 -57.500IDP90373 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_191 [Chlamydia trachomatis D/UW-3/CX]  ali  100  1MSFYPQNLPSFRRRKPSRTDSPIKHAKHFLRDHLSHLRKILAGKPQEVIEAWYEILGKKYNGMTQAIGLKDGILSIKVRNASLYAVLKQSSQKELISRIHSAVPGAKVKEIRFLLG 116
2 -9.990IDP06117 hypothetical protein jhp0759 [Helicobacter pylori J99] NP_223477 [Helicobacter pylori J99]  ali follow..  10  1.........................MEQNIFSLLIQKKSYKKLETLLKLKKLKVFMPLSLQENLLFIFIKDSKLLFAFKDLWASKEFNQRFAKEISHFLNT............... 76
3 -6.970IDP91504 putative translocation protein in type III secretion [Vibrio parahaemolyticus RIMD 2210633] VP1670 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  12  320.............QPTQPTREVNQLIQQLVDKVYVALPTASNEKEVRLFLSEGQLKGGEIH-----IKLDSQGYSVTIRQEHALSIINQQARQDLAERLNRMGFEQPLR....... 410
4 -5.610IDP90115 kelch-like protein [Monkeypox virus] MPXV_ZAI1979_005_024 [Monkeypox virus]  ali follow..  71............................IIGGMINNRHVYSVSRVDLKTKKWKTVTNMSSLKSEVSTCVNDGKLYV-LEFSISTGIAEYLKHGT-LITPRYSGASVFVNDDIYVMG 167
5 -5.450IDP92074 nucleoside diphosphate kinase, putative [Toxoplasma gondii ME49] TGME49_095350 [Toxoplasma gondii ME49]  ali follow..  10  38VALKMKSPDATLLEEHYADLKGKPFFPGLISYMTSGPVVCMVWEGTDVVKQGRRMLGETRPLESNPGTLRRNIVHGSDSVESANKEISLWFTPEEICEWTSAQHKWVYEQ...... 155
6 -5.340IDP04321 gene: ndk; nucleoside diphosphate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC0756 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  35IAAKMVHLSEEQASGFYAEHEGKPFFEPLKEFMTSGPIMVQVLEGENAIARYRELMGKTNPEEAACGTLRADYALSMRYNSVHGSDSPASAAREI..................... 129
7 -4.940IDP90542 gene: ndk; nucleoside diphosphate kinase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0332c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  33AAMKKVQLSKEQAENFYAVHKERPFFKDLVEFMISGPVVVSILEGEGAVLKNRDLMGATNPKEAKAGTIRADFAESIDANAVHGSDSLENAKIEI..................... 127
8 -4.800IDP02808 gene: yccK; sulfurtransferase TusE [Salmonella typhimurium LT2] STM1084 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  21.................................................TQWSEALAVAIAANEGIELSAEHWEVVRFVREFYLEFNTSPAIRMLVKAMANKFGEEKGNSRYL... 84
9 -4.640IDP90138 ankyrin-like protein [Monkeypox virus] MPXV_ZAI1979_005_181 [Monkeypox virus]  ali follow..  7................................................VKQW-DTLNGIMMNECDTVCVGTGLRFME--------MFFDYNKNNPKNSINNQIMYDIINSVAIILA 67
10 -4.630IDP91880 hypothetical protein lmo0753 [Listeria monocytogenes EGD-e] NP_464280 [Listeria monocytogenes EGD-e]  ali follow..  10  126..........................NQLLVNLLKSVTRKFEYIGEKVRMVSEDSVRAKISNYLFGIQDDDGSIELTETREEIADYLD-ITRPSLSRELGRMQKENIIR....... 207

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.