current user: public

If you have questions about the server, please let us know.

Query: IDP90396 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_552 [Chlamydia trachomatis D/UW-3/CX], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MFIKSFVHLCLLFSLTPTRLFSAAPISAHPSVTKKLSLRQLFKRFLPETSHNKKERYYHFLKHVSHALKRPEIWNDLQNLLLILMQFEQFANQEVGSRRYEEILSQIIEKRIHFLLSEQQVSELTDILAPKPGDLLast
1 -92.000IDP90396 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_552 [Chlamydia trachomatis D/UW-3/CX]  ali  100  1MFIKSFVHLCLLFSLTPTRLFSAAPISAHPSVTKKLSLRQLFKRFLPETSHNKKERYYHFLKHVSHALKRPEIWNDLQNLLLILMQFEQFANQEVGSRRYEEILSQIIEKRIHFLLSEQQVSELTDILAPKPGDL 135
2 -6.840IDP91328 ribonuclease G and E [Vibrio vulnificus CMCP6] VV2_0290 [Vibrio vulnificus CMCP6]  ali follow..  22  36..........................................................................NNPLNIEQ---RFETFSAPKYGFRAGARTLRTYQNKH------LNSIRELIHRFAPS.... 100
3 -6.010IDP00635 gene: modC; molybdenum ABC transporter, ATP-binding protein ModC SACOL2270 [Staphylococcus aureus subsp. aureus COL]  ali follow..  16  90........................................................NMTVYKNITFMAEPSEHIDQLIQTLNIDHLMKQYPMTLSGGEAQRVALARALSTKPDLILLDEPFSSL........... 157
4 -5.250IDP01884 gene: flgD; flagellar basal body rod modification protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0042 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  10  13.....................ATTSGTTSSGSTSGTTRTDSSSSSGIVSNPNATLDKDAFLKLLLIELQHQDPTDDSDKMLTQTSQLSALEMQQNTNTTMQKMVETM--QKLSDSFSTSMSTSALGAIG...... 120
5 -5.080IDP92131 alanyl-tRNA synthetase, putative [Toxoplasma gondii ME49] TGME49_019540 [Toxoplasma gondii ME49]  ali follow..  22  232.......................................................................EIWN------LVFMQYNREKDGSLTPLPAPCVDTGMGLERVASVLQDKQSNYDTDLFTA..... 284
6 -4.920IDP05710 gene: alaS; alanyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL1673 [Staphylococcus aureus subsp. aureus COL]  ali follow..  18  200.......................................................................EVWN------LVFSEFNHNKDHSYTPLPNKNIDTGMGLERMASVSQNVRTNYETDLFMP..... 252
7 -4.830IDP05327 gene: alaS; alanyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1504 [Listeria monocytogenes EGD-e]  ali follow..  22  200.......................................................................EIWN------LVFSQFNHNPDGTYTPLPKQNIDTGMGLERMVSIIQDAPTNFETDLFMP..... 252
8 -4.730IDP04730 alanyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS4284 [Bacillus anthracis str. Sterne]  ali follow..  20  200.......................................................................EVWN------LVFSQFNHNPDGSYTPLPKKNIDTGMGLERMTSIVQDVPTNFDTDLFMP..... 252
9 -4.710IDP04019 gene: spoIIIAH; stage III sporulation protein AH [Clostridium perfringens ATCC 13124] CPF_2080 [Clostridium perfringens ATCC 13124]  ali follow..  11  1MNRKQAGIILTLLALIVCTGVLATRVNNQIKESMGENATETSSNYFYESRNLREQKDSKTIDNLKAIVEDKNTSAEQKE-KTMARDYETRIELSIKSKGYEDVICFIDGDNAKVVLTQEKMVEIQDIVMNVSK.. 156
10 -4.690IDP90679 gene: alaS; alanyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0506 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  22  194.......................................................................EIWN------LVFMQYERSADGVLSPLPKPSIDTGMGLERVTAIKEGKFSNFDSSLFMP..... 246

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.