current user: public

If you have questions about the server, please let us know.

Query: IDP90432 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_865 [Chlamydia trachomatis D/UW-3/CX], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .
# Score Template Links and tools%idFirst MIKIAQSFKPYIMEPGAKILIPGSTLYAQVFPSLWRIFSSSHELVNEGRVPIQGPLQRFAVFQNLNRGGVAVMTEQYKYYLSPNGCYTRSIADLPSASFYSGEYVSFGVHKHADLEKIRRRKDLKEILPFLFRHGALLQNQPNLSMEKTEVALLLDTLDAAIAEPNKERVFSLLERFVYAGLSKTLLPRLYDEEYQGIVSEDPRPGNEAVPFSLLRAAALSMRRIFIQESDGVVTLLPALPPEFPCGRWIGLYLENIGEISFEWSKKTIRRVILKAHVSRELAIISPGVHSSRFRVEEQGRIISCKIKNLLEKVEIKAGTTYLWDRFCKLast
1 -124.000IDP90432 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_865 [Chlamydia trachomatis D/UW-3/CX]  ali  100  1MIKIAQSFKPYIMEPGAKILIPGSTLYAQVFPSLWRIFSSSHELVNEGRVPIQGPLQRFAVFQNLNRGGVAVMTEQYKYYLSPNGCYTRSIADLPSASFYSGEYVSFGVHKHADLEKIRRRKDLKEILPFLFRHGALLQNQPNLSMEKTEVALLLDTLDAAIAEPNKERVFSLLERFVYAGLSKTLLPRLYDEEYQGIVSEDPRPGNEAVPFSLLRAAALSMRRIFIQESDGVVTLLPALPPEFPCGRWIGLYLENIGEISFEWSKKTIRRVILKAHVSRELAIISPGVHSSRFRVEEQGRIISCKIKNLLEKVEIKAGTTYLWDRFCK 329
2 -6.410IDP05297 gene: mapA; maltose phosphorylase [Clostridium difficile 630] CD2188 [Peptoclostridium difficile 630]  ali follow..  10  438.................................NYTNYTGDYKYIKEKGIDVIIEIARFWASRSTKKDLYVTGPNEYENNINNNWYTNENILRLEKECNECIDRNNVTREEVEFWKIISNK-EVKDLPKENFPLNQNWSILRSCFIKQADVLQGIYYFGNRFTKEEKKRNFDFYESSLSSSIYSIIASEIDNLESRTARLDLDNYNNDTNDGLHITSMSGSWLSIVMRTWNETLSFDPKLPKEWKN-----------YSFNINYRDNIINLIKIENLKGKPIKIIVYG......................................... 748
3 -5.940IDP91976 hypothetical protein HMPREF0837_10616 [Streptococcus pneumoniae TCH8431/19A] HMPREF0837_10616 [Streptococcus pneumoniae TCH8431/19A]  ali follow..  13  53.........................................................................................................................................................................................................................................................KNLVENGDFGQTEDWSAWVDQKNSSADASTRVIE---AKDGAITISSPEKLRAAVHR------MVPIEAKKKYKLRFKIK 135
4 -5.790IDP01347 N-acetyl-anhydromuranmyl-L-alanine amidase VC2421 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  70..........................................................................................................................................................................................................................MRVSAHCVIRRDGEVVQFVPFHLRAWHAGSFAGRAKCNDYSIGIEYTDAQYQAL---TELTQALMVRYPHITLPRITGHQY---------------KTDPGLVFDWRRFRA 177
5 -4.720IDP05375 hypothetical protein BA_4118 [Bacillus anthracis str. Ames] BA_4118 [Bacillus anthracis str. Ames]  ali follow..  13  1..................................................................................................................................................................................................................................MKPTKIEIDVTDNKIYVVKNGEVTPLNPTGFGEQVITWQGGKVDRVSTTITE................................................... 54
6 -4.690IDP05447 conserved hypothetical protein [Bacillus phage lambda Ba01] BA_0441 [Bacillus anthracis str. Ames]  ali follow..  13  1..................................................................................................................................................................................................................................MKPTKVEIDVTDNKIYVVKNGEVTPLNPTGFGEQIITWQGGKVDRVSTTITE................................................... 54
7 -4.560IDP05700 hypothetical protein lmo2467 [Listeria monocytogenes EGD-e] lmo2467 [Listeria monocytogenes EGD-e]  ali follow..  17  299.............................................................................................................................................................................................................................................PTAPKSLMSHGQTD-------TIALCWQAST------------------DNVEVKNYEIYRNNTKIATSTKTMFEDTKLASNTSYNYK.... 362
8 -4.260IDP00522 gene: ampD; N-acetyl-anhydromuranmyl-L-alanine amidase YPO3423 [Yersinia pestis CO92]  ali follow..  12  70..........................................................................................................................................................................................................................LRVSAHCLIRRDGEIIQYVPFDKRAWHAGVFAGRERCNDFSIGIEFTPVQYQRLTISAVLFAHYPITVERVAGHSEIAPGR---------------KTDPGLAFDWFFYQQ 176
9 -4.200IDP90799 D-arabinose 5-phosphate isomerase [Yersinia pestis CO92] YPO3577 [Yersinia pestis CO92]  ali follow..  11  18...................................QVLQIEREGLAQLDQYINEDFSRACEAIFRCHGKVVVMGMGKSGHIGCKIAATFASTGTPAFFVHPGEASDLGMITPQD--AISNSGESNEILTLIPVLKRQ---ILLICMSSNPESTMGKAADIHLCINVPQGLAPTTSTTATLVMGDALAVALLKAR------TQEDFALSHPGGALGRKLLLRISDIMVSPDASLRDALLEITRK-DSMRIKGIFTDGDLRRVFDMGIDLNNAKIADVMTRGGIRVPPNILAVDALNLMESRHITALLVADGDQLLGV............. 316
10 -4.180IDP00855 gene: ampD; N-acetyl-anhydromuranmyl-L-alanine amidase STM0146 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  70..........................................................................................................................................................................................................................LRVSAHCLIRRDGEIVQYVPFDKRAWHAGNYQGRERCNDFSIGIEYTDAQYQQLAVTRTLIASYPAIADNMTGHCNITPDR---------------KTDPGPAFDWPRFRA 176

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.