current user: public

If you have questions about the server, please let us know.

Query: IDP90614 DNA polymerase III subunit beta [Vibrio cholerae O1 biovar eltor str. N16961] VC0013 [Vibrio cholerae O1 biovar El Tor str. N16961], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .
# Score Template Links and tools%idFirst MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLEGEFEAGSITVPARKFLDICRGLPDSAVITVLLEGDRIQVRSGRSRFSLATLPASDFPNIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLRSVATDGHRMAVAQAQLGADFAQKQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTSKLVDGRFPDYRRVLPQHTSKTLQTGCEELRQAFSRAAILSNEKFRGVRVNLADNGMRITANNPEQEEAEELLDVSFEGEPIEIGFNVSYILDVLNTLRCDNVRVSMSDANASALVENVDDDSAMYVVMPIRLLast
1 -118.000IDP90614 DNA polymerase III subunit beta [Vibrio cholerae O1 biovar eltor str. N16961] VC0013 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali  100  1MKFTIERSHLIKPLQQVSGTLGGRASLPILGNLLLKVEENQLSMTATDLEVELISRVTLEGEFEAGSITVPARKFLDICRGLPDSAVITVLLEGDRIQVRSGRSRFSLATLPASDFPNIEDWQSEVQVSLTQAELRGLIEKTQFSMANQDVRYYLNGMLFEIDGTTLRSVATDGHRMAVAQAQLGADFAQKQIIVPRKGVLELVKLLDAPEQPVVLQIGHSNLRAEVNHFVFTSKLVDGRFPDYRRVLPQHTSKTLQTGCEELRQAFSRAAILSNEKFRGVRVNLADNGMRITANNPEQEEAEELLDVSFEGEPIEIGFNVSYILDVLNTLRCDNVRVSMSDANASALVENVDDDSAMYVVMPIRL 366
2 -105.000IDP04571 DNA polymerase III subunit beta [Bacillus anthracis str. Sterne] BAS0002 [Bacillus anthracis str. Sterne]  ali follow..  26  1MRFSIQKDYLVRSVQDVMKAVSFRTTIPILTGIKVVATEEGVTLTGSDADISIESFIPVEEDKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLMTKITSGKSEFNLNGLDSAEYPLLPQIEEHHVFKIPTDLLKHMIRQTVFAVSTSETRPILTGVNWKVYNSELTCIATDSHRLALRKAKIEGIVDQANVVIPGKSLNELSKILDESEEMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDRNNVVKLSLEQAMLEISSNSPEIGKVVEEVQCEVDGEELKISFSAKYMMDALKALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVR. 377
3 -101.000IDP06076 gene: dnaN; DNA polymerase III subunit beta [Helicobacter pylori J99] NP_223170 [Helicobacter pylori J99]  ali follow..  22  1MKISVSKNDLENTLRYLQAFLDKKDASSIASHIHLEVIKEKLFLKASDSDIGLKSYISTQSTDKEGVGTINGKKFLDIISCLKDSNIVLET-KDDSLVIKQNKSSFKLPMFDADEFPEFPVIDPKVSLEINAPFLVDAFKKIAPVIEQTSHKRELAGVLMQFKHQTLSVVGTDTKRLSYTQLEKISTEEDISCILPKRALLEILKLF---YENFSFKSDGMLAVVENETHAFFTKLIDGNYPDYQKILPKEYTSSFTLGKEEFKEGIKLCSSLSST----IKLTLEKNNALFESLDSEHSETAKTSVEIEKGKAFHLGVNAKFFLEALNALGTTQFVLKCNEPSSPFLIQEPLDEKISTLMMPITL 374
4 -6.200IDP90779 gene: nusA; transcription elongation factor NusA [Yersinia pestis CO92] YPO3497 [Yersinia pestis CO92]  ali follow..  11  1.........MNKEILAVVEAVSNEKSLP--REKIFEALETAL-ATATKKKYEQEIEVRVSIDRKTGDFDTFRRW--VAVDEVTMPTREITLDAAQFEDPSLQLGDYVEDQIESVTFDRITTQTAKQVIV---QKVREAERAMVVEQFRQYLGQIVTGIVKKVSRDSIALDLGH----------------NAEAVIGREDMLPRENFRPGDRYDVRPEARGAQLFVSRSRSEMLVELFRIEVPE-------------------IGEELIEIKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAELGGERIDI---AQFVINAMAPADVASIVVDEDKHTMDVAVEASN............. 313
5 -6.180IDP04602 transcription elongation factor NusA [Bacillus anthracis str. Sterne] BAS3667 [Bacillus anthracis str. Sterne]  ali follow..  12  1.........MSTELLDALLVLESEKGIS--KDIIIDAIEAAL-ISAYKRNFNQAQNVRVSFNPQVGTIQVLARK--DVVDNVFDPRLEISVEEARQINPNYQDGDVLEIEVTPKDFGRIAAQTAKQVVT---QRVREAERGVIYSEFSDREEDIMVGIVQRQDARFIYV-----------------SLGKVEALLPVSEQMPNEQYKPHDRTKVEKTTKGPQIYVSRTHPGLLKRLFEMEVPE-------------------IYDGTVEIRSVAREAGDRSKISVHAENIDVDPVGSCVGPKGQRVQRELKGEKIDI---VEYVANALSPSQVVKVLVDEEEKATTVVVPDHQ............. 312
6 -5.020IDP05538 putative collagen-binding surface protein [Clostridium difficile 630] CD3392 [Peptoclostridium difficile 630]  ali follow..  12  757...................................KRVENDYTFIADEEEMKVEISYTFNASALGGKNLVTFEELYDLSNPDEPVKVAEHKDIEDDGQ--------TVLITERIIKIHTTATDKDGNKELEAGKDVTIIDTVTLEGLEVGTQYKLVGWQMLKEENA--ELLVNG----------------------KRVESDYTFIADSENMKVEVAFTFDATSLDGKQLVTFEELYDLSNTDEPKKVTEHKD--------------------IEDEGQTITFKEKPEVPEKPEQPQTPEKPSRPSDSPKTGDSTNL................................................. 986
7 -4.930IDP06274 gene: nusA; transcription elongation factor NusA [Streptococcus pneumoniae TIGR4] NP_345069 [Streptococcus pneumoniae TIGR4]  ali follow..  10  1.........MSKEMLEAFRILEEDKGIK--KEDIIDAVVESL-RSAYRRRYGQSDSVAIDFNEKTGDFTVYTVR--EVVDEVFDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGRVAAQSAKQTIM---EKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYV-----------------NLGSIEAQLSKQDQIPGEVFASHDRYKVEDNPRGVNVFVSRSHPEMIKRLMEQEIPEVYMSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKHPARYDAKNDRMVPIEENIDVIEWVADPA-----EFIYNAIAPAEVDQVIFDENDSKRALVVVPDNK............ 327
8 -4.740IDP05502 putative collagen-binding surface protein [Clostridium difficile 630] CD0386 [Peptoclostridium difficile 630]  ali follow..  14  757...................................KRVENDYTFIADDEAMKVEIAYTFNASELGGKNLVTFEELYD--LSNPDEPVKVAEIADDGQTVLITERIIKIHTTATDK---------DGNKELEAGKEVTIIDTITLEGLEVGTQYKLVGWQMLKEENA--ELLINGKRVE----------------------SDYTFTADSETMKVEVAFTFDATSLDGKQLVTFEELYDLSNPDEPKKVTEHKD--------------------IEDEGQTITFKEKPEVPEEPETPQTPEKPSRPSDSPKTGDNTNL................................................. 986
9 -4.340IDP04566 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1876 [Clostridium perfringens ATCC 13124]  ali follow..  74STTEFSDSELTDLFI--LALREEPDAIKDLTGLKVDIENDDINIYVD-KNIPFQGKLTFTAQSKDGKGIFHYKEGKVGFIDISKDTIFKNLQDNSILSFDKTNGDIILSFKDIIKYLQIKSIKVENVFNGTIPLLSSIFPN................................................................................................................................................................................................................................. 219
10 -4.140IDP05402 gene: comGD; comG operon protein 4 [Bacillus anthracis str. Ames] BA_4463 [Bacillus anthracis str. Ames]  ali follow..  2...........................................................................................................................KQKGFTLLEMLLVLFAISVLSMVTYFNVHSLYEKQKIEQFLRQFSNDILYMQQLAINR-----------------------------QKHYTLRWHKDRHMYYIGESSTDLSIIKREYDSDIQLDLNTFPNPMTYNPSGNINRGGTILLSYRSYKYEIVFQLGRGRFTYREMSKRVSDG................................................................ 151

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]