current user: public

If you have questions about the server, please let us know.

Query: IDP90877 oxidoreductase, zinc-binding dehydrogenase family [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1548c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# Score Template Links and tools%idFirst MQYKILENNRIASKGYAMLSKDAKFTPFEFSRHAIGDNDILIKILYAGICHSDIHTARSEWGEATYPCVPGHEIAGEVIAVGKNVSKFKVGDYAGVGCMVNSCGECDACKRSQEQFCENGKTIFTYNSCDVFHGNENTYGGYSNNIVVSEKFAVCVPKDAPMEKVAPLLCAGITTYSPLKFSNIKEGSSVAVAGFGGLGMMAVKYAVKMGAKVSVFARNENKKADALAMGVSSFYTSCDKNAVKERFDLIISTIPTPYNPAIYLDLLKFGGEMAIVGLPPHEVAPSISVITFVHKAGKKVYGSLIGGIAETQEMLDFSLKHGIYPETELITPQEIDKAYENLTSGKAKFRYVIDMTKELast
1 -111.000IDP90877 oxidoreductase, zinc-binding dehydrogenase family [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1548c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali  100  1MQYKILENNRIASKGYAMLSKDAKFTPFEFSRHAIGDNDILIKILYAGICHSDIHTARSEWGEATYPCVPGHEIAGEVIAVGKNVSKFKVGDYAGVGCMVNSCGECDACKRSQEQFCENGKTIFTYNSCDVFHGNENTYGGYSNNIVVSEKFAVCVPKDAPMEKVAPLLCAGITTYSPLKFSNIKEGSSVAVAGFGGLGMMAVKYAVKMGAKVSVFARNENKKADALAMGVSSFYTSCDKNAVKERFDLIISTIPTPYNPAIYLDLLKFGGEMAIVGLPPHEVAPSISVITFVHKAGKKVYGSLIGGIAETQEMLDFSLKHGIYPETELITPQEIDKAYENLTSGKAKFRYVIDMTKE 358
2 -57.400IDP04681 gene: adhB; alcohol dehydrogenase, zinc-containing [Bacillus anthracis str. `Ames Ancestor`] GBAA3131 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  19  1............MKAVTYQGPNQ-VQVKQVDDAKEKKDDIIVKITSTAICGSDLHLYQGNMP-LPQGYIIGHEPMGIVEEVGPDVTKVKKGDRVVIPFNV-ACGHCFYCQHEMESQCDNSNPHYDSGGYGYTEKFGNHPGGQVEYLKVPFGTPFVIPESCELEDESLLFLSDVTAYWSVINAGVKPGDTVIVLGCGPVGLMTQKFAWMHGARVIAVDYLDYRINYAKKINNVEVFEFTKFPDMHGGADVVIDCVGMDGPIQIATKAVRKYGTVQMTGVYGGNY--NAFPLGAFWVRNINLKMGQAPVIHFMPELFEKITNKEFDPITHKIPLEEASYGYQIFNNREDDCIKVI..... 374
3 -56.800IDP00931 gene: ybdR; putative dehydrogenase STM0615 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  20  1............MKALTYHGPHH-VKVENVPDPGEQPDDIILRVTATAICGSDLHLYRGKIPQVKHGDIFGHEFMGEVVETGHDVKNIRKGDRVVIPFVI-ACGDCFFCRLQQYSACENTNDGHGAAMNKKQIPYGGVPGGQAEYVRVPKGGPFKVPPLLSDDKALFLSDILPTAWQAAKNAQIQQGFSVAVFGAGPVGLLTIACARLLGAQIFVVDHHAWRLRFAEERYGAIPINFDDENDPHRGVDAVIDAVGFEKALRQCIAAVRRGGVVSVPGVYAGF--IHGFLFGDAFDKGLTFKMGQTHVHAWLGELLPLIEKGLLKPVTHYMPFEEAARGYEIFEKREEECRKVI..... 385
4 -55.900IDP02503 gene: gutB; putative zinc-binding dehydrogenase [Yersinia pestis CO92] YPO2502 [Yersinia pestis CO92]  ali follow..  18  49LLEELMSQLPEKMSAVVCHGPQD-YRLEHVPTPVPKAKELVIKVKGCGICAGDCKCKNGA-PWVKPPVVPGHEFYGHIVALGEGTSKYKLGERVIAEQIV-PCWDCRYCNSGSYWMCETHNIYGFQKD--------VAEGGMAEYMRFSENAIVKIPESLSHEDAVPMACA----IHTVARGDIQLDDVVVLAGAGPLGLCMVPVARLKTPKLIVIDTIEERLALAKAFGADVVINPLKEDADGYGCDVYIEATGAPIGVTQGLQMIRKLGRFVEFSVFGQETTVDWSII--GDRKELDIRGAH-LAPYSYEIATDLFERGLVTSVTHSYSLDDWEKAFELADSTNS-IKVILV.... 407
5 -50.200IDP04685 alcohol dehydrogenase, zinc-containing [Bacillus anthracis str. `Ames Ancestor`] GBAA3438 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  20  1............MKAQIIHSFGDSFQLEEVSKPKLLPGHVLIDVKATSVNPIDTKMRSGAVSAPEFPAILHGDVAGIVIEVGEGVSKFKCGDEV-----------------------------------GCAGGFKETGGALAEFMLADARLIAHKPNNITMEEAAALPLVAITAWESLDRANIKSGQNVLIHGTGGVGHVAIQLAKWAGANVFTTASQQNKMEIAHRLGADVAINYKEESTNGNGFEVIFDTVGGK-NLDNSFEAAAVNGTVVTIAARST------HDLSPLHAKGLSLHVTFMALKEILTKITKIVEEGKLRPLLKSFTFDEVAQAHEYLESNKAIGKIVLK.... 332
6 -49.800IDP00076 gene: yhdH; putative oxidoreductase NT01ST4228 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  1............MQALILEQQDGKASVQHLEESQLPAGDVTVDVHWSSLNYKDALAITGKGKIIRFPMIPGIDFAGTVHASE--DPRFHAGQEVLL----------------------------------GWGVGENHWGGLAERARVKGDWLVALPAGLSSRNAMIIGTAGFTAMLCVDAGIRPQDGEVVVTGAGGVGSTAVALLHKLGYQVAAVSGRESTHGYLKSLGANRILSRDEFALEKQLWAGAIDTVGDK-VLAKVLAQMNYGGCVAACGLAGGFA--LPTTVMPFILRNVRLQGVDSVMAEAWARLVKDLPESFYAQAATEITLADAPKFADAIINNQVQGRTLVKIK.. 324
7 -10.300IDP95362 set237a-002 [Escherichia coli]  ali follow..  15  43..................................................................................................................................................................................IKHGCINKKSHLLDLACS-TGFSSRECFKKEGASAEGIDISESAVMVANELKANNLLKYYVADACDNTFTHVLGIQNRLIALNETHRCLNHMGSMCISNF................................................................................ 156
8 -10.000IDP95361 set237a-001 [Yersinia pseudotuberculosis PB1/+]  ali follow..  16  41..................................................................................................................................................................................IEKSRINSNTYLLDLACS-TGFSARNIVHKTGCSAEGIDISARSIESANQLNIAECVHFSVGNAESNTFTHITAISDKPAALVEVQRVLKQDGFLCISPF................................................................................ 154
9 -9.640IDP02524 gene: ilvC-2; ketol-acid reductoisomerase [Bacillus anthracis str. `Ames Ancestor`] GBAA1852 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  18  15.........................................................................................................................................................................................QGKTVAVIGYGSQGHAQAQNLRDSGVEVVVGVRPGKSFEVAKADG----FEVMSVSEAVRTAQVVQMLLPDEQQAHEVEENLREGQMLLFSH................................................................................. 106
10 -9.630IDP95479 S-adenosylhomocysteinase Q5CPH1 [Cryptosporidium parvum]  ali follow..  15  212.........................................................................................................................................TTTGVLRLKIMESEGKLLLPDSVTKSKFDNTYGCRQSLLHGLFNGC--AGKKIVVLGYGEVGKGCAQGLSGVGARVIVTEIDPICALQASMEG----YQVSVLEDVVSEADIFITATGNKDVITEHMRKMKENAYIANIGHFDDEIDVYGL------------------------ENYPGIKVIEVKQNVHKFTFPDTQKSVILLCKGRL........... 401
11 -9.230IDP01412 cyclopropane-fatty-acyl-phospholipid synthase VC1122 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  165..............................................................................................................................................QHYDLGNELYQLFLDEEMLYSSALSLEQAQQAKMQRLEQLQLKPTDHVLEIGTG--GAMAIYMAQHYGCKVTTTTISEEQYAYAQQLNNQITLLKQDYRLLSGQYDKLVSIEMIEAVLSQCYALLKPRGKMAIQAITIADQRYESYSNNVDFIQKYIFPGGFLPSISVLTELAT.......................................... 358
12 -9.090IDP02330 gene: ilvC-1; ketol-acid reductoisomerase [Bacillus anthracis str. `Ames Ancestor`] GBAA1419 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  18  16.........................................................................................................................................................................................KEKKVAIIGYGSQGHAHAQNLRDNGFDVVVGLRKGKSWDKAKEDGFS----VYTVAEAAKQADVVMILLPDELQPEEIAPNLQAGNSLVFAH................................................................................. 107

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.