current user: public

If you have questions about the server, please let us know.

Query: IDP91022 gene: ompC; outer membrane porin protein C [Yersinia pestis KIM 10] y2966 [Yersinia pestis KIM10+], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370
# Score Template Links and tools%idFirst MITMKLRVLSFIIPALLVAGSASAAEIYNKDGNKLDLYGKIDGLHYFSDNKNLDGDQSYMRFGLKGETQITDQLTGYGQWEYQVNLNKAENEDGNHDSFTRVGFAGLKFADYGSLDYGRNYGVLYDVTSWTDVLPEFGGDTYGADNFLSQRGNGMLTYRNTNFFGLVDGLNFALQYQGKNGSSSETNNGRGVADQNGDGYGMSLSYDLGWGVSASAAMASSLRTTAQNDLQYGQGKRANAYTGGLKYDANNVYLAANYTQTYNLTRFGDFSNRSSDAAFGFADKAHNIEVVAQYQFDFGLRPSVAYLQSKGKDIGIYGDQDLLKYVDIGATYFFNKNMSTYVDYKINLLDKNDFTKNARINTDDIVAVGMVYQFLast
1 -111.000IDP91022 gene: ompC; outer membrane porin protein C [Yersinia pestis KIM 10] y2966 [Yersinia pestis KIM10+]  ali  100  1MITMKLRVLSFIIPALLVAGSASAAEIYNKDGNKLDLYGKIDGLHYFSDNKNLDGDQSYMRFGLKGETQITDQLTGYGQWEYQVNLNKAENEDGNHDSFTRVGFAGLKFADYGSLDYGRNYGVLYDVTSWTDVLPEFGGDTYGADNFLSQRGNGMLTYRNTNFFGLVDGLNFALQYQGKNGSSSETNNGRGVADQNGDGYGMSLSYDLGWGVSASAAMASSLRTTAQNDLQYGQGKRANAYTGGLKYDANNVYLAANYTQTYNLTRFGDFSNRSSDAAFGFADKAHNIEVVAQYQFDFGLRPSVAYLQSKGKDIGIYGDQDLLKYVDIGATYFFNKNMSTYVDYKINLLDKNDFTKNARINTDDIVAVGMVYQF 374
2 -98.900IDP91024 outer membrane protein C2 [Yersinia pestis KIM 10] y2983 [Yersinia pestis KIM10+]  ali follow..  61  1...MKRNILAILIPTLLVATTSHAAEIYNKDGNKLDLYGKVKALHYFSDNTKSDGDKSYVHLGFKGVTQITDELSGYGQWEYNFAANYAESQE-AKDNKTRLAFAGLRYGNLGSIDYGRNYGVLYDIAAWTDMLPEFGNDSYTRDNFMTGRTTGVATYRNTDFFGLVDGLKFSLQYQGKNGAEGETNNGRDTSKQNGDGFGLSSSYEIGAGVSVGAAYASSNRTLAQKNSTFGKGDKADAWTTGLKYSDNGVYLAANYAETRNMTPISGTANNVSTSVSGFANKTQNIELVAQYLFDFGLKPSIAYIQSKGKDIEGIGDTDLVKYVDIGATYYFNKNMSTYVDYKINQLNDDNK---LKLNTDNVVALGLVYQF 371
3 -91.400IDP04214 gene: ompN; outer membrane protein N precursor [Salmonella typhimurium LT2] STM1473_1_377 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  63  1...MKRKVLALVIPALLAAGAAHAAEIYNKDGNKLDLYGKVDGLHYFSDDSSKDGDQTYMRVGFKGETQINDQLTGYGQWEYNVQANTTE--GEGANSWTRLAFAGLKFGDYGSFDYGRNYGVLYDVEGWTDMLPEFGGDSYTADNFMTGRANGVATYRNTDFFGLVDGLNFALQYQGANENQVSHEQEGTNNGANGDGFGISSTYDLGMGVSFGAAYTTSDRTNGQVNYSTAGGDKADAWTVGAKYDANNIYLATMYSETRNMTPYGN-----DDCRSCVANKTQNFEVTAQYQFDFGLRPAVSFLMSKGKDLTYNNDKDLVKYADVGATYYFNKNFSTYVDYKINLLDDDDQYKDAGISTDDIVALGMVYQF 377
4 -78.300IDP01391 outer membrane protein OmpU VC0633 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  23  7LNKMNKTLIALAVSAAAVATGAAGSTVYSAKGTSLEVGGRAEARLSLKDGK--AQDNSRVRLNFLGKAEINDSLYGVGFYEGEFTTNDQGKNASNNSLDNRYTYAGIG-GTYGEVTYGKNDGALGVITDFTDIMSYHGNTAAEK-IAVADRVDNMLAY-KGQFGDLGVKASYRFADRNAVDAMGNVVTETKYSDNGEDGYSLSAIYTFG-------------DTGFNVGAGYADQDDQNEYMLAASYRMENLYFAGLFTDGELAK----------------DVDYTGYELAAGYKLGQA-AFTATYNNAETA------KETSADNFAIDATYYFKPNFRSYISYQFNLLDSDKV---GKVASEDELAIGLRYDF 350
5 -64.600IDP01409 porin, putative VC0972 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  1MKMFKRTLLGAAVAMASGAFAASETGAIGVLSDFVQAYGVAAISAFYQEDSNGYDYENESRIGFRASKDMFDNVNVFMQIESGYVGEDGK----GSTLGARDTFLGLQ-GDWGKVRFGRMLTPLYEIVDWPYSNPGLGRDWGGDVAGHYDRKGDIARYDSPAFGGLTFNISAGRGDVGTKS---------------SNHFGAAAHYNAADIVTFHVGYENNSDTAGKDVDNTFLTDATAYIVGFELPLPAGFGLAGAYKYTE----------GASKTVKGQEGEQGQYSLIGQYWNGP-WGFKVGYAANLESEVNGVEQK-DDDEVLSAQLMYVKNGFVPYIRVGQHDAYDSA-------DKKGFVRVGLEYGF 349
6 -19.900IDP01504 gene: lamB; maltoporin VCA1028 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  1...MELTMKKVSVIAAAVAATLAAGS-----AFAVDFNGYFRAGTGISGNG-----NADQAVNKAGTGRLGNENDNYYEFGFAEELKTGENGWEDGDFNVAQFNVQAKG---AVMWAGKRYYQRKDIHITDFYFLNTSGTGGGIENLSVGNQKLSVALVQDGDNTNSSGYIFDARLAN-AMAYNFATEKDSKNEVADDGVLVSAQYGTAGYGAQAANFWGAGSYYARGTEAFNDASGFRLLNWGVINLGENWEMGLAYLAGSDIGGQFGGDGANKNTYTGKSFDIDQYSVVVRYKWNDTMRTVAGYNAGEKISNGGLATEDFAQAWAMGDSFWARPELRVYGTYLL------TENDKAFGDDDTEFVVGIQVEA 414
7 -17.500IDP01498 long-chain fatty acid transport protein VCA0862 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  1...MLYKSSLAVAISALIAGQVSAA--FQVAEHSASGLGRAFSGEAAVADNASVLARNPAAMMLFETAQFSGALSIVDEVNVDDLSNNQSMKDVAPLQIVPAAYWGLAFTTYGVATYAGDLAGDTSLISV--------------------NLNPNIAYRVNPELSLGFGLDLGGLAPFMGGGNPSDNLIGMTGETLALGWNIGALYELDEQNRIGFGYRSRVKLNFDDGEFSSYDSGIAIWELSGFHQLNEVHYSYQQTDWSSFEELTATSSQCKNGTCFQKQDNGRWSVGATYTLNTTWTLRAGLAFDEQ-KATLSIPDSDRFWYSAGLTYTLTPQLTMDAGFALVQSRKGSFTEKNQEAVAYISALQFNYRF 411
8 -16.800IDP00542 gene: fadL; long-chain fatty acid outer membrane transporter YPO2744 [Yersinia pestis CO92]  ali follow..  12  1MVMNQKNLFTRSALAAAIALISSNVSAFQLNEYSAAALGRAFSGEGAVADNASVGSRNPAAMTLFDRPSFSGGVIYID--SVDITGTSPSGKSTDASNIAPSAWVGASTSNYGLATVAGMLGGQTDLKTA--------------------NLNLSAAYRLNDNFSFGLGFDAHLGEAGGGLLPANTEAARLEGTKWGYGWNTGILYEIDKENRYSFTYRSEVNIDFDGDYSNQLPVIFAVWEVSGYNKVAPIHYSMAYTTWSSFKELKATASNGDVLFDKHEGDAYRIALGTTYYYDDNWTFRTGIAFDDSPIPAGNRSDQDRFWLSAGTTYAFNKNASVDVGIAYMKGQNVSITEKTPKGSAMLYGVNFNYTF 423
9 -16.300IDP90337 CHLPN 76kDa Homolog [Chlamydia trachomatis D/UW-3/CX] CT_623 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  10  1...MKKYFYKGFVGALLLACGSTNLAFAQASSGVLRLAGDVRARWIYAKEDLETTQTPAKEFNLYVDYTAANSWMT--------WVTIAGGESSAAGLDINRAFLGYRFYKNPEVFAEIGRSGLGDI---FDSDVQFNSNFDGIHLYAARRISEKLPFTMIVHGG---------PFVVNMAEKEYAWVVEAILNKLPGNFVVKTSVVDWNTLTAKTNDPADASAAQPAKPNTKYDYLVWQWLVGKSTAMPNLYTYGAYLFNPLAEIPENWKQSTTPTTKITNGKENAWFIGCSLG-AGDWSATVRYEYVEALDPKESNGFTNYKGVSYQFVMGLTDSVSFRAYAAYSKPANDNL---GSDFTYRKYDLGLISSF 432
10 -14.000IDP02013 gene: pgtE; outer membrane protease [Salmonella typhimurium LT2] STM2395 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  10  1...MKKHAIAVMMIAVFSVYAESALFIPDVSPDSVTTSLSVGVLNGKSRELVYDTDTGRSQLQGDLSWEPYSFMTLDARGWTSLASGSGHMVDHD--------WMS-----------------------------------------------------------------------SEQPGWTDRSIHPDTSVNYANEYDLNVKGWLLQGDNYKAG------------------------TAGYQETRFSWTARGGSYIYDNGRYIGNFPHGVRGIGYSQRFEMPYIGLAGDYRINDFECNVLDEHYMRKLTFREKTENSRYYGASIDAGYYITSNAKIFAEFAYSKYEEGKGGAAGIANNNYTVTAGLQYRF 312
11 -13.400IDP00165 gene: acfA; accessory colonization factor AcfA VC0844 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  1...MQKTLSAIFLFTTLSANAA-----YIGLELGIGTANHSFETNYQSDAVSLNPNMEDMFLGGLIGYKFNDNFSF----------------------------------EINYSSYKL------------------------------------------------EDQYSKFIGIESLNNQQYRKEHEWSSEIEAKQLALISVYSYPIHQQLKTNIK----------------------------------VGVTHTQYEAYSGKYEELELLLNDDIEIR---------------------------KALLETGLKKNRFGALFSLGLDYNLIPELSVGTELRYQFDKYNDV---------LSISLNSKYYF 215
12 -13.300IDP90997 gene: ompX; outer membrane protein X [Yersinia pestis KIM 10] y1682 [Yersinia pestis KIM10+]  ali follow..  12  1.MVMKKIACLSAVAACVLAVTAGSAF-----------AGQSTVSGGYAQSDYQGVANKSSGFNLKYRYEWSDSQLG----YITSFTHTEKSGFGDEAVYNKAQYNAITGG--PAYRINDWASIY---------------------------------------------GLVGVGHGRFTQNESAFVGDKHSTSDYGFTYGAGLQFNPAENVALDVSYEQSRI----------RNVDVGTWVAGVGYTF............................................................................................................................. 176
13 -13.000IDP01854 gene: pagC; virulence membrane protein PAGC precursor [Salmonella typhimurium LT2] STM1246 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  7.........................................................................................................................................................................................................STLVITTSVLVVNVAQADTNAFSVGYAQSKVQDFKNIRGVNVKYRYEDDSVSFISSLSYYGDRQASGSVEPEGIHYHDKFEVKYGSLMVGPAYRLSDNFSLYAGVGTVKATFKNKISSRKTGFAWGAGVQMNPLENIVVDVGYEGSNISSTKI---------NGFNVGVGYRF 185
14 -11.500IDP01776 gene: ybfM; putative outer membrane protein [Salmonella typhimurium LT2] STM0687 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  1MRTFKRSTLALAIAGITAMSGWIVVPQAQADDSTLTG--GIYYWQRERDRKDVTDGDKNANLDFQSGY-FGLDIAAFTAIEMAENGDSGDYSGDKSGISLYKAAAKFKYGPV-WARAGYIQPTGQTLLAPHWSFGTYQGAEAGA------------SFDYGDAGALSFSYMWTNEYKAPWHTEMDKFYQADKKTNVDYLHSIGAKYDFKNDLVLEAAFGQSEGRDKVDDRSVNDIYDGTAWLQALTFGYKVLRLEGTWVKADGQQGYFLQRMTPTYASSNNANGEKAVFFGAMYDLKPGWAVGASYVYSNPDAYYDKNRTIEESSYSLDAVYTLQKGTMFKLHFTEYDNHSNGGGYGNIFQDERDVKFIVIAPF 465
15 -11.500IDP91534 major outer membrane protein precursor [Chlamydia trachomatis] CAA36299 [Chlamydia trachomatis]  ali follow..  11  1...MKKLLKSVLVAALSSASSLQALPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDSMRMGYYGDFVFDRVLKTDVNKEFEMGEALAGASGNTTSMFTNAACMTLNIWDFCTL--GATSGYLKGNSASFNLVGLFGDGVNATKPAADSINQSVVELYTDTTFAWSVGARAALATLGASFQYAQSKPKIEELNVLCNAAEFTINKPKGYVGKEFPLDLTAGTDAATGTKDASIDYHEWQASLSLSYRLNMFYIGVKWSRASFDSDTIRIAQPRLVTPVVDITTLNPTIAGCGSVAGANTEGQISDTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRL---------------DERAAHVNAQFRF 395
16 -10.800IDP91023 hypothetical protein y2980 [Yersinia pestis KIM 10] y2980 [Yersinia pestis KIM10+]  ali follow..  13  1...MNKHLVACAASLLLVAGSASAVSF------NAETGRH-------YTNLGFGLGTNTGGLAISGNWARSDHDGDVLGLGLGFNLPVGPMT----TVGAKGIYMSPEDGSGGAVAIG---------------------------------------------------------------------------------------------------------------------------------------------------------------------------GGLSYPINKSFSVYGEGYFA----EELTSGMKSYSEANGGVRWNVFRPLTVDVGYRYINMEGKE--GRRDNRLADGVYIGAGLNF 180
17 -10.500IDP90313 gene: ompB; Outer Membrane Protein Analog [Chlamydia trachomatis D/UW-3/CX] CT_713 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  11  1MKLVNYLRLTFLSFLGIASTSLDAMPAGNPAFPVI--------------------------PGINIEQDLCNSY-----------------------DVLSALSGNLKLCFCGDYIFSEEAQVKDVPVVTSV------TTAGVGPSPDITSTTKTRNFDLVNCNLNTNCVAVAFSLPDRSLSAIPLFDVSFEVKVGGLKQYYRLPMNAYRDFTSEPLNSESEVTDGMIEVQSNYG----VWDVSLKWKDGVSFVGVGADYRHASCPIDYIIANSQANPEVFIADSDGVCVGLTTYVNDYVLPYLAFSIGSVSFKVRKITSSHRGNICIGATNYVADNFFYNVEGRW---------------SQRAVNVSGGFQF 340
18 -10.200IDP95251 ferric acinetobactin receptor [Acinetobacter baumannii ATCC 17978] YP_001085406 [Acinetobacter baumannii ATCC 17978]  ali follow..  247....TTHLFSLGL--------------WRGDNARLSA-PKAPNPDTLLNPTWTVYNTRDTGGMIRGEYDLNDKWMAYATAGMSIQNEAGDIKFNIAHLGFKYERKSAEVGLRGKFDTG---AVKHALALNATHYRETDDEAGIRQGFPEGNLTSVGLADTMSVLQDQVQLTLGLRYQNIVTESLNGQGVRNINGRYDKN-AAAILVKANDHVSLYANYIEGLSSGGTVPTGQNYENKTKQMETGIKIDSGNFTNTFSVKSRNSYVIKSTDEKIKSIYGADGEQRNRGVEWGFYGSPVDSIRVMGGLTYIDPKITKTRIASELGNQAKLGIEGDVSPGLTLTANATAASKQYIYNDNSTSVPGREVYGIGARYNT 688
19 -10.100IDP90305 gene: ompA; Major Outer Membrane Protein [Chlamydia trachomatis D/UW-3/CX] CT_681 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  12  1...MKKLLKSVLVAALSSASSLQALPVGNPAEPSLMIDGILWEGFGGDPCDPCATWCDSMRVGYYGDFVFDRVLKTDVNKEFQMGAKPTTDTGNSAAMFTNAACMALNIWDFCTL--GATSGYLKGNSASFNLVGLFGDNENQKTVKAESFDQSVVELYTDTTFAWSVGARAALATLGASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGKEFPLDLTAGTDAATGTKDASIDYHEWQASLALSYRLNMFYIGVKWSRASFDADTIRIAQPKSATAIFDTTTLNPTIAGAGDVKTGAEGQLGDTMQIVSLQLNKMKSRKSCG-IAVGTTIVDADKYAVTVETRL---------------DERAAHVNAQFRF 393
20 -10.000IDP01451 outer membrane protein OmpK VC2305 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  11  28VPLMRKSLLALSLLAATSAPVLAAD--YSDGDIHKNDYKWMQFNLMGAFDELPGKSSHDYEMEFGGRSGIFDLY---------VDVFNLATNKSSDKVGDPKIFMKFA----PRMSLDAFTGVDMSFGPVQEVYVASLFEWDGTDFKTNAFSVNNQKI----------GLGSDVMVPWFGKVGLNLYGTYDGNRKDWNGFQISTNWFKPFYFFEN----------------------------GSFISYQGY---------------------------------------IDYQFGLK----------------DEYSTASNGGAMFNGIYWHSDRFAVGYGLKGYKDVYGIKDTDGFKSTGFGHYVAVTYKF 296
21 -10.000IDP91017 gene: fcuA; ferrichrome receptor, TonB dependent [Yersinia pestis KIM 10] y2556 [Yersinia pestis KIM10+]  ali follow..  11  287....RLTAVSTGLDYRSDRARTSLDVGYQKQTIAVTVIPEPPSTTLNYGQPWVYTDLETTFGMLRSEYDVSQNWTVYGSIGASLTDNSGNATISRLYVPYISESIAGLGGIRGHFDTGNIYNPGVIPFPPTSTNPNFYSPNQDPTLTSQVRASGFSLSDTLSMMDDKVQLMLGVRRQDVTIRNFNNGVPNSAGSLDAMKVTYGVLVRPWEKVSLYANHIEALGPGKSAPNEFNGKPHSKQNEVGVKFDNQRYGGTLALFEITRPTGTVDPATNTYGFYG--EQRNRGVELNVFGEPVLGTRLLGSAVWLDPKLTKTQNGTNNGNQLVFGGEYDIPEGLTATGTLTRSGSQYANDANTLKIKPWTRLDLGVRYTM 728
22 -9.730IDP95175 capsular polysaccharide synthesis protein CpsB [Klebsiella pneumoniae 700603] EMR18996 [Klebsiella pneumoniae 700603]  ali follow..  1.......MLLYIPWVHADLQGKAHTGI-----AGIDFESQLGYDIGYNDNNDSADNRNNHFFMFNGKWRFGKMHGLSLDLDETLGHEERGQDTTEGFLPEQFKEFGIKKPI-LRYSYGAPEGRGKVEVALLRKQLRFRDLDSIKAASDDFDYYMHDQEWNENSLVAELFDQKAKTLRYRYSFITNQRRYELNPLKDSNEYYLLFGMKNRLSGKTEINGNVAWLYKDFIHNPDSQGFNGLNWDITADWKPLEQM----------KFNLHSSQRIKDPTDSGGYILVSNFGVGYEHHWVDRFSTLVDYSYITEDYKHQSNKKDQSNLLSLTFNYDFRPSINFKLKLQWNTMHSNKDTDTFYIGDDSAIIFMTQVQI 419
23 -9.710IDP95105 fimbriae stability-associated protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002921124 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  10  1MKGLPKNTIAWLLFCGSLAAPSAWGFETNYDRGRVDFAGRVDISCSVALNGGQHAGSGNVWLAPVSLAEVHGAGAFMKPQPFTLALSN.............................................................................................................................................................................................................................................................................................. 91
24 -9.520IDP01315 hypothetical protein VC0942 VC0942 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  8.IIMNHIGLFALTAAALLAGCSSNTQQDNYREASFELCNTVNIYSVSDDGQVRIVCADGAKFALKTEKTLDRDINVDYCDGEGLG-----------KFTESNKYYMFKCKSGTMISVSK............................................................................................................................................................................................................................................................... 117
25 -9.370IDP00563 gene: hmuR; hemin receptor precursor YPO0283 [Yersinia pestis CO92]  ali follow..  1MLRFRWSSLSLAIACTLPLATQAADTTTTQTSSKKH---STDTMVVTATGNERSSFEAPMMVTVIEGNAPTATAADMLRQVPGLTV-TGSGRTNGQDVVMR----GYGKQGVLTLVDGVRQGTDTALVKRIEIV-----RGPAALLYGSGALGGVIAYETVDAADLQPGQNSGYRVYSSAATGDHSFGLGASAFGRTDDLDGILSFG----------TRDIGNIRQSNGFNAPNDETISNVLAKGTWQIDSLSANLRYYNNSAIEPKNPQTSAPSSTNVMTNRSTIQRDAQLRYNIKPNATAQVYYSEVEINARPQGSAEEGREQTTEGVKLENRTRLFI-TETYKQEQTPGGATESFPQAKIRFSSGGTRYD. 406
26 -9.270IDP91535 gene: ompA; major outer membrane protein, porin [Chlamydia muridarum Nigg] TC_0052 [Chlamydia muridarum str. Nigg]  ali follow..  11  1...MKKLLKSVLAFVLGSASSLHALPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDSLRLGYYGDFVFDRVLKTDVNKQFEMGAAPTGDADLTTEMFTNAAYMALNIWDFCTL--GATSGYLKGNSAAFNLVGLFGRDETAVAADDIPNSQAVVELYTDTAFAWSVGARAAL---GASFQYAQSKPKVEELNVLCNAAEFTINKPKGYVGQEFPLNIKAGTVSATDTKDASIDYHEWQASLALSYRLNMFYIGVKWSRASFDADTIRIAQPXLETSTTWNPTISGSGIDVDTKITDTLQIV--------SLQLNKMKSRKSCGLAIGTTIVDADKYAVTVETRL---------------DERAAHVNAQFRF 387

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.