current user: public

If you have questions about the server, please let us know.

Query: IDP91167 gene: aroE; shikimate 5-dehydrogenase STM3401 [Salmonella enterica subsp. enterica serovar Typhimurium], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst METYAVFGNPIAHSKSPFIHQQFAQQLDIVHPYGRVLAPINNFINTLDAFFAAGGKGANITVPFKEEAFARSDELTERASLAGAVNTLKRLEDGRLLGDNTDGIGLLGDLERLNFIRPGLRILLIGAGGASRGVLLPLLSLDCAVTITNRTASRAEALAKIFAHTGSVHATDMDKLDGCEFDLIINATSSGIRGEIPAIPASLIHPSLCCYDMFYQKGNTPFLSWCVQQGAKRYADGLGMLVGQAAHAVLLWHGVLPQVEPVIEQLQQELLALast
1 -108.000IDP91167 gene: aroE; shikimate 5-dehydrogenase STM3401 [Salmonella enterica subsp. enterica serovar Typhimurium]  ali  100  1METYAVFGNPIAHSKSPFIHQQFAQQLDIVHPYGRVLAPINNFINTLDAFFAAGGKGANITVPFKEEAFARSDELTERASLAGAVNTLKRLEDGRLLGDNTDGIGLLGDLERLNFIRPGLRILLIGAGGASRGVLLPLLSLDCAVTITNRTASRAEALAKIFAHTGSVHATDMDKLDGCEFDLIINATSSGIRGEIPAIPASLIHPSLCCYDMFYQKGNTPFLSWCVQQGAKRYADGLGMLVGQAAHAVLLWHGVLPQVEPVIEQLQQELLA 272
2 -102.000IDP02433 gene: aroE; shikimate 5-dehydrogenase [Coxiella burnetii RSA 493] CBU_0010 [Coxiella burnetii RSA 493]  ali follow..  45  1MDKYAVIGNPVEHSLSPVIFQAFEKQTNHSFDYLKIKAPVNGFAAAVKKFHDEGGKGANITLPFKEEAYQLADKRSQEANEAHVASALQFREDGTIYAVNYDGLGLVQDLTRHNITLTQKSILIVGAGGATRGILGPLLNAAPKIVIVNRTPSKAHALAKIFHLRGEIQGGGFDELEPMRYDVIIHATSLGHQGKFPPLPDGLIGSQSCCYDLSYGKIASPFLQWAKDQGAKYNFDGLGMLVEHNAAVFYLWFGIYPDTNPVIEMLQAHL.. 272
3 -101.000IDP90792 gene: aroE; shikimate 5-dehydrogenase [Vibrio cholerae O1 biovar eltor str. N16961] VC0056 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  50  5IDQYAVFGNPINHSKSPFIHTLFARQTQQSMIYTAQCVPVDGFTEAAKHFFAQGGRGCNVTVPFKEEAYRFADRLTERARLAGAVNTLKKLDDGEILGDNTDGEGLVQDLLAQQVLLKGATILLIGAGGAARGVLKPLLDQQPSITVTNRTFAKAEQLAELVAAYGEVKAQAFEQL-KQSYDVIINSTSASLDGELPAIDPVIFSSRSVCYDMMYGKGYTVFNQWARQHGCAQAIDGLGMLVGQAAESFMLWRGLRPGTKQILRELRKNLEG 276
4 -94.100IDP91168 similar to shikimate 5-dehydrogenase (AroD) lmo1490 [Listeria monocytogenes]  ali follow..  33  1MEKYVVIGNPIRHSLSPAMQNRIFQELGMNAEYNSVLIEEDAFETEIKKLMDSGVRGFNITTPFKERILPFLDELDNLAAASGAVNTVLK-KEDKWYGFNTDGKGYLEGLEEIRSITEDDSILITGAGGASKAIYLALSTHTDKITVANRTTEKAIEMTKDNNNHHAITLEEAEKQ-LADFTIIIQTTSIGLEANKSPISLANVKQGTICSDIIYNPAETAFLKEAKKNGAITQ-NGLPMFVNQGALAFEIWTGIKPERSLMKEAVLEQLGG 272
5 -93.700IDP04636 gene: aroE1; shikimate 5-dehydrogenase [Francisella tularensis subsp. tularensis SCHU S4] FTT0238 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  28  3.DLYHVIGFPVKHSLSPAIQMRLAQQYNQDMLFTAIEVAPQDLEAKIQEFKTPQVKGLSVTVPHKERVYALADDADTTAKAVQAASNVIFTAERKMIALNYDGLGIVNDIKNYKIDFAGKKVLVVGAGGAAKAVVAAVLKESPSLSITNRTLAKAKAIEELFKVDTKIKIIDFDNI-SDSFDIVINSTSSSIDGKLLPLKDSNFNKNAFAYDLMYADGGTIFTKWCQAHNIAAA-DGKGMLKELSIAVFKYWRGL................. 257
6 -91.200IDP90166 gene: aroE; shikimate dehydrogenase [Clostridium difficile 630] CD1837 [Peptoclostridium difficile 630]  ali follow..  27  1MNFFGLVGEKLSHSVSPQIHKRVFEILNIESAYKNFEISKEDISKLDGAIKLLGIQGVNVTVPYKERIMKYLDFISPEAKRIGAVNTILL-RENMLYGYNTDYFGLDSMFKMANIDVQGKVAVILGTGGASKAALTYFIDSGIKLYVSTRKKDDKKLLNSKAI------LIDYEELKHIKGDIILNATPVGMYPGISPVSKSIIQNFDILIDLIYNPGETEFLRIGNSMGKKTC-DGLYMLVGQAIKSQEIWQDTKIDNSILDVIYNE.... 263
7 -91.100IDP04232 gene: aroE; shikimate 5-dehydrogenase [Clostridium perfringens ATCC 13124] CPF_0693 [Clostridium perfringens ATCC 13124]  ali follow..  28  1MKLFGLIGEKLGHSLSPEIHNKVFKDNNIDGLYNLFSVKKDFENNIVESLKCLGVKGANVTIPYKEKVMDQLDIISHEAKAIGAVNTILI-KDGKSYGYNTDYYGFGKMLERAKVNIEGNSFFVLGAGGAARSILKYLEDSKAKIVLVSRDREKAFKKFKDFNINFMSYG---ELEEINEEFALINTTPCGMYPNSVAVSEKVIKKFKVAVDIVYNPLETKFLKMAKDNGLKTV-DGLFMLVGQGVKAEEIWNGIKVDKSTEEDIYEE.... 266
8 -89.200IDP91166 gene: aroE; shikimate 5-dehydrogenase STM1359 [Salmonella enterica subsp. enterica serovar Typhimurium]  ali follow..  26  8.ELIGLMAYPIRHSLSPEMQNKALEKAGLPYTYMAFEVDNTTFASAIEGLKALKMRGTGVSMPNKQLACEYVDELTPAAKLVGAINTIVN-DDGYLRGYNTDGTGHIRAIKESGFDMRGKTMVLLGAGGAATAIGAQAAIEGIEIKLFNRKDDFFEKAVAFAKRVTDLADQHAFTEALASADILTNGTKVGMKPESLIGDVSLLRPELLVTECVYNPHMTKLLQQAQQAGCKTI-DGYGMLLWQGAEQFELWTGKAFPLDYVKQVMGFT... 287
9 -89.100IDP91169 similar to shikimate 5-dehydrogenase lmo0490 [Listeria monocytogenes]  ali follow..  26  14.ELIGLIATPIRHSLSPTMHNEAFAKLGLDYVYLAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVN-DDGVLTGHITDGTGYMRALKEAGHDIIGKKMTICGAGGAATAICIQAALDGVEISIFNRKDDFYANAEKTVEKINDIEDHEQLRKEIAESVIFTNATGVGMKPETLLPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQTL-NGLGMMLWQGAKAFEIWTHKEMPVDYIKEIL...... 290
10 -88.400IDP90864 gene: aroE; shikimate 5-dehydrogenase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0405 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  30  1MKFLAVIGDPISHSKSPRMHNNAIKALGLDSIYTRYHLRNAN--CLREDFFKLGLSGANITLPFKEKALDIADVKDDFARNIGSANTLCL-KEDKIYAYNTDALGFLEAIKD---FDNIKKALILGAGGTALALAYVLKQKGVEVYIANRSKERFKDFLAYPT-------YLYKNLQDFDFDLVINSTSAGLKDENRELLDRILPKAKFAFEVIYGR-ETPFYRLCKEYHLKIK-DGLDMLLWQGVFAFELFFEIQDKREMIKNAMQQALIL 261
11 -88.300IDP02833 gene: aroE; shikimate 5-dehydrogenase [Bacillus anthracis str. `Ames Ancestor`] GBAA4561 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  31  3.QLYGVIGNPIGHSLSPVMHNDAFEHLKMDAHYHAFLVKEEVLGEAVRGLKALGISGFNVTTPHKVAIMDYLDEIDPLAKQIGAVNTVVH-KDGKLIGYNTDGIGFVRALQSSSEPLQEKRILLLGAGGASRAIYFSLADAGVEIDVANRTVDKAKELIAACTATVHSVALSLEKATQGNYDIIIQTTTIGMHPEHTPLQISSLKKGTIVSDIIYNPFETKILCEAKEQGAIIQ-NGIDMFVYQGALAFEMWTGCVPNIERMKQLVIRNLEA 277
12 -86.800IDP91170 similar to oxidoreductase lmo2236 [Listeria monocytogenes]  ali follow..  28  10.RLLGLIGTPIDHSKSPIMYNYSFQKAGLDYAYLAFDTPIQKVADTIKAIKTFNLRGANVTMPCKSEVLKHMDDLSPAARMIGAVNTIVN-EDGKLTGHITDGLGFIANLRDASVDVAGKKMTIIGAGGAATAIQVQCALDGAEITIFNIFYDKAKQTVASIKQEVPNCIVHIYDLNITTSDILVNATLVGMHPNTPISDTSVFRKELIVADIIYNPKKTQLLLDAEAAGCKTV-GGLGMLLWQGAEAYKLFTGKDMPVSEVKDLYFN.... 289
13 -83.500IDP90926 gene: aroE; shikimate 5-dehydrogenase [Salmonella typhimurium LT2] STM3859 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  22  12..CMSLAARP--SNFGTRFHNYLYEALDLNYLYKAFSP--TDLTQAISGVRGLGIRGCAISMPFKEACIPLVDELDASAQAIHSVNTIVN-TNGHLKAYNTDYIAIARLLAN-YKVSPDLVFALRGSGGMAKAVACALKDAGFRGYIVAIDEASGKQLAELYGYEWR------PDTDGIEADLLINATPIGMAGGNLSYSEQEVDKASVIFDVVALPPVTPLIRYARERGKTVI-TGSEVFAIQAVEQFVLYTGIRPDDALFQKAAAWS... 270
14 -83.000IDP90721 gene: aroE; shikimate 5-dehydrogenase [Yersinia pestis CO92] YPO1610 [Yersinia pestis CO92]  ali follow..  21  31.VCISLAARP--SNFGTRFHNFLYDALDLDYLYKAFTT--NDLAAAIGGVRALGFRGCAISMPFKEAVIPMVDEMDPSAKAINSVNTLVN-TGGYLKAYNTDYIAIAKLLQEYQ-VPVDNVFALRGSGGMAKAVAFALKNAGFQGYIIATNEKTGKQLAEQSG------YIYRPDMQNIQADMLINATPVGMAGGALAFTETEVDRAKIVFDVVALPAVTPLIRYAQTQGKTVI-TGAEVFAIQAVEQFVLYTGIRPSQALFEQAAAYAR.. 291
15 -81.000IDP91204 shikimate 5-dehydrogenase [Bacteroides thetaiotaomicron VPI-5482] BT_4215 [Bacteroides thetaiotaomicron VPI-5482]  ali follow..  27  1MEKYGLIGYPLRHSFSIGYFNEKFRSEGINAEYVNFEI--PNINDFMEVIEEPNLCGLNVTIPYKEQVIPFLNELDRDTAKIGAVNVIKIKGKVKLVGYNSDIIGFTQSIQP-LLQPQHKKALILGTGGASKAVYHGLKNLGIESVFVSRTHKTDDMLTYE----------ELTPEIMEEYTVIVNCTPVGMYPKVPNIPYELLTPNHLLYDLLYNPNVTLFMKKGEAQGAVTK-NGLEMLLLQAFAAWEIWH................... 247
16 -77.200IDP91203 gene: aroE; Shikimate 5-dehydrogenase [Bifidobacterium longum DJO10A] BLD_0429 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]  ali follow..  19  4.HRCAVLGKPVAHSLSPVLHNAAYRSLKLDWLYDKHEVGEDDLDAFLKGLDS-TWAGLSLTMPLKKTIQPYGVPENLWAKELKVANTAVFDGKPGIKLYNTDVIGIQLAFDHANRELRSGTALIIGNGNTATSALAACCMMPGHIVVAARHPGKNTGLKPVAEKFVNVHNPYNELEAARNATYVINTIPGHAADNDALANAGTEPFSGLLLDVIYDPRPTKLMEAWRAHGGHAI-GGEEMLLYQALVQVLLMTGIWDPSDADQRLQDTTTED 308
17 -73.900IDP91171 RecName: Full=Shikimate biosynthesis protein AroDE; Includes: RecName: Full=3-dehydroquinate dehydratase; Short=3-dehydroquinase; AltName: Full=Type I DHQase; Includes: RecName: Full=Shikimate dehydrogenase CT_370 [Chlamydia trachomatis]  ali follow..  23  215.PICALIG-DTSRSIGHLTHNPFFSQLGVACPYIKLPLTPQELPKFFSTIRTQPFLGVSVTSPLKTAVLPFLDKQAPSVKASGSCNTLVI-RQGEIEGHDTDGEGLFSVLMQHQIPLNNQRVAIIGAGGAAQSIATRLSRANCELLIFNRTKAHAEDLASRCQ----AKAFSLEELPLHRVSLIINCLPPSCTIPK--------AVAPCVVDINTIPKHSTFTQYARSQGSSII-YGHEMFTQQALLQFRLWFPTLSFKHLEKTFIRRAAVL 470
18 -39.600IDP92648 RecName: Full=Pentafunctional AROM polypeptide; Includes: RecName: Full=3-dehydroquinate synthase; Short=DHQS; Includes: RecName: Full=3-phosphoshikimate 1-carboxyvinyltransferase; AltName: Full=5-enolpyruvylshikimate-3-phosphate synthase; Short=EPSP synthase; Short=EPSPS; Includes: RecName: Full=Shikimate kinase; Short=SK; Includes: RecName: Full=3-dehydroquinate dehydratase; Short=3-dehydroquinase; Includes: RecName: Full=Shikimate dehydrogenase AFUB_013230 [Aspergillus fumigatus A1163]  ali follow..  25 1290.KRFALFGSPISESRSPALHNTLFAEMGLPHEYTRLET--ANVEDVKDFIRAPDFGGASVTIPLKLDIMPLLDEITAEAEIIGAVNTVVPVSDGRLVGHNTDWQGMVQCLRNAGAYGGSASALVVGGGGTSRAAIYALHQMGFSIYIVGRNPAKLESMVSTFPTSYNIQIVEGNEKLEHVPHVAIGTIPADRPIDDADASRTIEGSPRVLLEMAYKPRVTALMQLAVDAG--TTIPGLEALIGQGVHQVGLWTGIRPLYERARVCCDILLSG 1598
19 -15.900IDP90674 gene: hemA; glutamyl-tRNA reductase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0542 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  12  59..........VKMACAEFIVKSLALLCDVDKDILLEKADIFEDSGAIHHLFSVA-SSLDSLVVGETQIAGQLKDAFAFAVKNNFCGVHLSRNETQISKNSISVASVAVAKAKELADLTQKKAVVIGAGEMGELAAKHLIAAGAKVIILNRDLQKAKDLCERLGVLSEYDSLENLKKYLNQYEFFFSATNA----PNAIITNSLIEEKRYFFDIVFAVDDLEIVVQKNLALREQEARMAYGIIGRETSEFFRYLNDL-ALMPIIKAIRLQAKE 345
20 -13.100IDP02777 gene: hemA; glutamyl-tRNA reductase [Bacillus anthracis str. `Ames Ancestor`] GBAA4698 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  16  63............HTGRYYIKKFLADWFQLEIEEVAPYLTIFEQDGAIDHLFRVT-CGLDSMVVGETQILGQIKDSFLEAQQVKATGTIFNETLAKRAHSETTSYAAVELGKKIFGELTDCHVLILGAGKMGELALQNLYGSGAKVTVMNRTLSKAEIMAEKYM--GHAKPLSELQCALLEADILISSTGAS-KEMMTKVEKMRSGRPLFMVDILYDIDDLQGVVEANRAERLKEAEKIQFMIEEEIVLFKTWLSTL-GVVPLISALRDKALA 354
21 -12.700IDP02291 gene: hemA; glutamyl-tRNA reductase [Francisella tularensis subsp. tularensis SCHU S4] FTT0167 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  95...........................................TEVIMHLMKLA-CGLESMVLGEPQILGQVKDSYTLSKKNHAIGKELDRATAKRVRSETRAFSAITLAKRQLDNISSKNVLIIGAGQTGELLFRHVTALAPQIMLANRTIEKAQKITSAFRNASAHYLSELPQL-IKKADIIIAAVNV---LEYIVTCKYVGDKPRVFIDIYYCVDDINAVIEDNKDKRKYESSKAQKIIVKSLEEYLEKEKAI-ISNSAIKELFQKADG 349
22 -12.500IDP91454 gene: hemA; glutamyl-tRNA reductase [Vibrio vulnificus CMCP6] VV1_0254 [Vibrio vulnificus CMCP6]  ali follow..  16  59..........VKSGARSKVIDWLSQFHQIGLEELKPSLYVYEEQAAIRHLMRVS-CGLDSLVLGEPQILGQVKQAYSDSREQQAVDASLEKSVAKRVRTETDAYAACTLAKHIFESLEKSTVLLVGAGETIELVAKHLHANGCKMIVANRTRERALTLAEQFD--AQVISLQEIPNHLAKADIVISSTASP-KGMVETALKQRRHQPMLLVDILYTVDDLQSIIDSNIEQRKVEAIQAEAIVAEESAAFMSWLRSLQAVDSIRE........ 345
23 -12.400IDP04169 gene: hemA; glutamyl-tRNA reductase [Vibrio cholerae O1 biovar eltor str. N16961] VC2180 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  59..........VRSASKNKVIEWLSQFHQVSLDELKPSLYVHEEQAAIRHLMRVA-CGLDSLVLGEPQILGQVKQAYAEARENHAVNPATEKSVAKRVRTETEAYAACTLAKHIFESLADATVLLVGAGETIELVAKHLAGHHCRMIVANRTRERALSLAQQFG--ADVIALNEIPDYLAQADIVISSTASP-KGMVESALKARRHQPMLLVDILYSVDDLQSIVDSNIEQRKVEAIQAEAIVSEESATFMSWMRSL-QAVDSIRDYRKQANE 352
24 -12.400IDP90936 gene: hemA; glutamyl-tRNA reductase [Yersinia pestis CO92] YPO2016 [Yersinia pestis CO92]  ali follow..  16  105.......................................................SGLDSQVLGEPQILGQVKKAFAESQRGQSLSSELERSVAKRVRTETEAFAACSLARQIFESLSELHVLLVGAGETIELVARHLREHQVHMIIANRTRERAQSLASEVG--AEVITLPEIDARLADADIIISSTASP-KGMVERALKTRRNQPMLFIDILYSVDDLQAIIQHNMAQRQAAAVQAESIVQQESMNFMTWLRAQGAVETIRD........ 347
25 -12.200IDP02522 gene: hemA; glutamyl-tRNA reductase [Coxiella burnetii RSA 493] CBU_1966 [Coxiella burnetii RSA 493]  ali follow..  18  101.......................................................SGLDSMVLGEPQILGQMKQAYLLARRIGAVGSELGRAATKRIRSETAAYAVVQLAKRIFSHLNQCQILLIGAGETIELVFSHLYNQGAHFFIANRTLTRAKQIAEPYH--AQAIRLSDIPTYLPKVDIVISATMSQ-KGAVESALRQRKRRPLFMADLLYNIDDLQTLIAQNRQTREAAAKQAEAMVEMQAIHYMRQLQVH-KAGDTIRRFRERVEM 350
26 -11.000IDP01849 gene: folD; methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase putative bifunctional protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0892 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  13  38.....IVGNDPASKTYVASKEKACAQVGIDSQVITLHTTESELLELIDQLNNSSVHAILVQLPLPAHINK--NNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLGIMTMLREYGIKTEGAYAVVVGASNVGKPVSQLLLNAKATVTTCHRFTTDLKSHTT-------------------KADILIVAV-----GKPNFITADMVKEGAVVIDVGINHVDGKIVGDVDFAAVKDVPGGVGELLYNTFQCAQ...................... 278
27 -10.500IDP01640 short chain dehydrogenase/reductase family oxidoreductase [Bacillus anthracis str. `Ames Ancestor`] GBAA4357 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  14  4...................................................................................................................RLQNKVIVITGASGIGEQVAMQVAEQGATPVLMARTEEKLKALADKIKETYNTPCFSKVLQEVGRIDILVNNAGFGIFKTFEDASMDEVKDMFQVNVFGLVACTKAVLPYMVKRNEGHIINIASLAGKIATPKSSAYAATKHAVLGFTNSLRMELSS 177
28 -10.300IDP90810 gene: folD; folD bifunctional protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0855 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  37.....LVGDNPASQTYVKSKAKACEECGIKSLVYHLNITQNELLALINTLNHDSVHGILVQLPLPDHICK--DLILESIISSKDVDGFHPINVGYLNLGLESGFGVMKLLKAYEIDLEGKDAVIIGASNVGRPMATMLLNAGATVSVCHIKTKDLSLYTR-------------------QADLIIVAA-----GCVNLLRSDMVKEGVIVVDVGINRLESGKI-SKKSSYITPVPGGVGMLLENTVKSAKNRLN.................. 282
29 -10.100IDP06281 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [Streptococcus pneumoniae TIGR4] NP_345317 [Streptococcus pneumoniae TIGR4]  ali follow..  14  39.....LVGDNPASQVYVRNKERSALAAGFRSEVVRVTITQEELLDLIAKYNQPAWHGILVQLPLPKHIDE--EAVLLAIDPEKDVDGFHPLNMGRLWSGHPTPAGIMEMFHEYGIDLEGKNAVVIGRSNVGKPMAQLLLAKNATVTLTHSRTHNLSKVAA-------------------KADILVVAI-----GRAKFVTADFVKPGAVVIDVGMNRDENGKLVAPLASHITPVPGGVGMLMEQTYQAALRTLDRK................ 285
30 -10.000IDP02528 gene: folD; methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase [Bacillus anthracis str. `Ames Ancestor`] GBAA4405 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  39.....LVGEDPASRSYVKGKEKGCEQVGIYSELIEFTITEERLLAEIDRLNGDRINGILVQLPLPKHIEE--KAIIERISPEKDVDGFHPISVGRMMTGQDTPHGIVELVKETNLDISGKHVVVIGRSNVGKPVGQLFLNENATVTYCHSKTQNMKELTK-------------------LADILIVAV-----GRPKMVTADYIKEGAVVIDVGVNRLETGKLVLDVASYITPVPKGVGMLLHNTVESAKRAGVVC................ 285
31 -9.980IDP01638 gene: folD; folD bifunctional protein [Coxiella burnetii RSA 493] CBU_0312 [Coxiella burnetii RSA 493]  ali follow..  17  40.....LVGNDPASATYVAHKERACQAVGIRSTVYRMTITESELASKIDECNRSNTHGILLQLPLPAHIDP--ANLLERIRPDKDVDGFHPYNLGRLVQRRPTPYGVMTLLTETHENLEGKHAVIVGASNVGRPMALELLLAKCTVTVCHRFTRDLAEHVK-------------------SAELLIVAI-----GKPGIIQSEWIKPGAIVIDVGFSRLSPNKIAKERASWITPVPGGVGTLLENTLQAAQ...................... 280
32 -9.420IDP02370 gene: fabG; 3-ketoacyl-(acyl-carrier-protein) reductase [Bacillus anthracis str. `Ames Ancestor`] GBAA1958 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  17  1.............................................................................................................MLYLAELLQGKNALITGAGGIGRAVAIALAKEGVNVGLLARSEENLKAVAKEVEAEGVKAVIATADVSSYEIDILINNAGISKFGKFLELDVA--------WEKIIQVNLMGVYYATRAALPSMIEQQSGDIINKGAPVTSAYSASKFGVLGLTESLAMEVRK 179
33 -9.210IDP02121 Short-chain dehydrogenase/reductase [Francisella tularensis subsp. tularensis SCHU S4] FTT0360 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  18  4.....................................................................................................................NSKTILITGCGGIGYATAVHLKNLGHRVFASARQQKDVEALSQEGFETYLIDVTNYEYIDNASLDVIFNNAGYGQAGALEDIDTKFLKQQFETNVFGLHNLTYKALKIMRKQGYGKIIQHSSVLGLVAMKYRGAYNASKYAIEGLTDTMRLELRD 170
34 -9.190IDP02237 short chain dehydrogenase/reductase family oxidoreductase [Bacillus anthracis str. `Ames Ancestor`] GBAA3440 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  1................................................................................................................MHMQLKGKTALVTGSTGIGKAIATSLVAEGANVLINGRREENVNETIKEIRAQYP-QGCQDVIEKYPKVDILINNLGIFEPVEYFDIPDEDWFKLFEVNIMSGVRLTRSYLKKMIERKEGRVIFIASEAAIMPSQEMAHYSATKTMQLSLSRSLAELTTG 174
35 -9.030IDP90757 gene: ilvC; ketol-acid reductoisomerase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0632 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  19  16....................................................................................................................IKSKKVAIIGFGSQGHAHAMNLRDNGVNVTIGLREGSVSAVKAKNAGFEVV-------SEASKIADVIMILAP................................................................................... 83

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35