current user: public

If you have questions about the server, please let us know.

Query: IDP91172 gene: pcrV; type III secretion protein PcrV [Pseudomonas aeruginosa PAO1] PA1706 [Pseudomonas aeruginosa PAO1], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# Score Template Links and tools%idFirst MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAILast
1 -133.000IDP91172 gene: pcrV; type III secretion protein PcrV [Pseudomonas aeruginosa PAO1] PA1706 [Pseudomonas aeruginosa PAO1]  ali  100  1MEVRNLNAARELFLDELLAASAAPASAEQEELLALLRSERIVLAHAGQPLSEAQVLKALAWLLAANPSAPPGQGLEVLREVLQARRQPGAQWDLREFLVSAYFSLHGRLDEDVIGVYKDVLQTQDGKRKALLDELKALTAELKVYSVIQSQINAALSAKQGIRIDAGGIDLVDPTLYGYAVGDPRWKDSPEYALLSNLDTFSGKLSIKDFLSGSPKQSGELKGLSDEYPFEKDNNPVGNFATTVSDRSRPLNDKVNEKTTLLNDTSSRYNSAVEALNRFIQKYDSVLRDILSAI 294
2 -64.000IDP91311 hypothetical protein VP1659 [Vibrio parahaemolyticus RIMD 2210633] VP1659 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  34  404..............................................................................QEKKDLEVRAEHSLTARDLLAVVESSIGDRFDEQVLFALNERRVNRLEKRNEQKEALQDLTVQLKIFGVVQSKIHSTQSVDGTYKPDDNAFSASD---FNYN-SVTDFQNSPEYKYLTD----NGITTHTDFL----KKQGVTVADGASFKDEEKTKKLSNFSSSVSDKSKLLNDEVQIKTTELNDISSQYNSTVEAMNKFVQKYHSILQEILRAI 607
3 -6.540IDP01714 gene: flgB; flagellar basal body rod protein FlgB [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0528c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  1.........................................................................................................................................MINPFKSKELVTGALAGRNLRNQLI-----NANLANVDTPFYKARDIEFETA-----LVNRANEIFKKNDNKELQLAVTEEEHQKPWKFPDPSKSTIYLRDGHLARNDAN----TVDLDVETTEMSKNTVMITALDGVLRRQSNIFSSILD...... 137
4 -6.510IDP04060 gene: mxiI; MxiI, component of the Mxi-Spa secretion machinery [Shigella flexneri] CAC05813 [Shigella flexneri]  ali follow..  15  28......................................................................................................................................................................................................................................DVVSAKYSDIKMDTDIQVSQIMEMVSESLAKLQTTLSNYSIGVSLAGTLARKTVSAVETLLKS. 97
5 -6.500IDP93928 virulence associated protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007710 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  15  34..........................................................................................................................................................................................................................................KKGANITVAAEREKAALINGADSELLQFQSRMNNYNHAINFIATLTHKGASAIDSVLKA. 99
6 -6.200IDP05015 gene: fliE; flagellar hook-basal body protein FliE [Clostridium difficile 630] CD0247 [Peptoclostridium difficile 630]  ali follow..  15  34.............................................................................................................................................................................................................................................KNFEDVIIDTIDKVNFSMHEVMLIGQEAQLSMQYLIEVRNKIHDAYQEMNK...... 102
7 -6.080IDP01827 gene: fliE; flagellar hook-basal body protein FliE [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0526c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  19  27.............................................................................................................................................................................................................................................DEFAKMLKNEINDLNKDLHQAAIAITKAESSMKFMLEVRNKAISAYKEITR...... 95
8 -5.560IDP93821 putative type III secretion apparatus [Yersinia enterocolitica subsp. palearctica Y11] YP_006007031 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  11.........................................................................................................................................................................................................................................AQSINKIGQDFQSQMASGNPSDPEHMLKMQFAMQQYSSYINFSSALMKNIKDMTSGIIAKI 71
9 -5.480IDP91489 type III export protein YscF [Vibrio parahaemolyticus RIMD 2210633] VP1694 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  14  17.............................................................................................................................................................................................................................................TKLEQQAKDANKSVTDAIKNLETNADDPSNKWSVVYNINATTTRAIKDVMQSILQKV 82
10 -5.250IDP93927 hypothetical protein YE3551 [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007709 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  6..................................................................................................................................................................................................................LDATGKWNPSALEAPDITSTGHNMGMVYRALAPLNGMIAQHGTALAEAFKDPKLLTSNFNFGRQFQSNCLKTFRDTTGVCIR.. 100

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.