current user: public

If you have questions about the server, please let us know.

Query: IDP91270 acetyltransf2, N-acetyltransferase [Bacillus anthracis str. Sterne] NT05BA3459 [Bacillus anthracis str. Sterne], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MTDFQKQFFARLNIEEKQKVSFEDLSNIMYAMAQTVPFENLNVLEKNFKEISQENLKEKILVNNRGGLCYELNPTMYYFLKDAGFDVYLVSGTVYNAANSIWAVDSGHIATILKHHNELYLIEVGFGSYLPLAPVPFSGEVVQSVTGDYRIRKEMTEKGNYMLEMRKNDEFLDQSSTDDWTLGYAFYIEEVDEKKQMQHKKLLLNTMAHHLTKYLLLLast
1 -100.000IDP91270 acetyltransf2, N-acetyltransferase [Bacillus anthracis str. Sterne] NT05BA3459 [Bacillus anthracis str. Sterne]  ali  100  1MTDFQKQFFARLNIEEKQKVSFEDLSNIMYAMAQTVPFENLNVLEKNFKEISQENLKEKILVNNRGGLCYELNPTMYYFLKDAGFDVYLVSGTVYNAANSIWAVDSGHIATILKHHNELYLIEVGFGSYLPLAPVPFSGEVVQSVTGDYRIRKEMTEKGNYMLEMRKNDEFLDQSSTDDWTLGYAFYIEEVDEKKQMQHKKLLLNTMAHHLTKYLLL 217
2 -12.400IDP02574 protease, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA1995 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  16  132VKSQAKAIIGSI---KPGMDEHEKVKAIHDYVVKHVSYDT---------SYQAYTAYEALANRS--AVCQGYTLLTYELLKEAGIQNRIVTGT---------GNGQAHSWNLVNIENKWYHLDTTFDD......................................................................................... 237
3 -11.200IDP05354 hypothetical protein CD3043 [Clostridium difficile 630] CD3043 [Peptoclostridium difficile 630]  ali follow..  12  51VAQATADFMNKK---TKNMTTDAKILVAYNHIKNNTTYVD-------WNAVEGANTAYTLVTKK--GACSGMARSMKALCDAMGIESYYVHST-----------SNDHQWNLIRFDGRLYHVDIDANK......................................................................................... 157
4 -10.800IDP95076 hypothetical protein CD630_11560 [Peptoclostridium difficile 630] YP_001087648 [Peptoclostridium difficile 630]  ali follow..  12  62VAQATADFMNKK---TKNMTTDAKIRVAYNHIKNNTTYVN-------WNAAEGANTAYTLVTKK--GACSGMCRSLKALCDAMGIECYYVHSTT-----------NDHQWNLIRFDGRLYHVDIDANK......................................................................................... 168
5 -8.940IDP91497 hypothetical protein VP1683 [Vibrio parahaemolyticus RIMD 2210633] VP1683 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  155GQKGSQFYETKGAPRLKALYANQARIAQDQRATMSASAVQAAAQRGNAPQLSTLQNIAKYVQNAKAGCCTTFAFAAAAEMIQGMSGTPENQPKVE--VAFKKGHSGTHLYVLVTWNKDVKIVD.............................................................................................. 288
6 -7.200IDP01023 gene: sseI; secreted effector protein [Phage Gifsy-2] STM1051 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  160.................................................ELKQNPIINNKIMNPVGQ-CESLMTPVSNFMNEKGFDNIRYRG-IFIWDKPTEEIPTNHFAVVGNKEGKDYVFDVSAHQFENRGMSNLNGPLILS--------------------------------ADEWVCKYRFSNSSIAANAYDA---LPRELESESMAGKVFV 302
7 -6.140IDP92246 RecName: Full=Vancomycin B-type resistance protein vanW EF_2296 [Enterococcus faecalis]  ali follow..  12  45LPYLLFETDCALYNHNTGFDMIYQENKVFNLKLAAKTLNGLLIKPGETFSFGLTVANGKLTTMSGGGMCQMSNLLFWVFLHTKGVDATISEGWIDLKVRNDTD---CTYQIWVTLDDEKIIGQV-FADKQPQALYKIANGSIQ.......................................................................... 221
8 -5.760IDP92247 gene: vanWG; VanWG [Enterococcus faecalis] ABA71730 [Enterococcus faecalis]  ali follow..  12  81................NLKLAAKTINKVIIEPKETFSFWQLVRWADRHEKYKDGLNLGKIVGSYGGGLCQLSNMLFWLFLHTCGTDATINEGWLDLKLRNDTD---NTFQIEISFDDNFMYGRI-LSQSSVNIEYTVFNSSVSYFKREEKVYQIAS............................................................. 241
9 -5.750IDP02801 gene: pdp; pyrimidine-nucleoside phosphorylase [Listeria monocytogenes EGD-e] lmo1993 [Listeria monocytogenes EGD-e]  ali follow..  35.DYQASALAMAIFFQDMNDQERADLTMAMVGSGDTIDLSEIEG--------------IKVDKHSTGGVGDTTTLVLAPLVAAVGVPVAKMSGRGLGHTGGTIDKLESIEGFHIELDKKDFVNRDKVA.......................................................................................... 149
10 -5.620IDP01620 gene: hslU; ATP-dependent protease ATP-binding subunit [Francisella tularensis subsp. tularensis SCHU S4] FTT0687c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  16  344LKSLEIEDFVRI-LREPDCSILKQYIALMKTEGIDLSFEEDAIR-----KIAEIAYKVNEEVENIGA---RLHTVMERLLEKISFDAPELVEKNINITTDYVNEKLGN--LVKNKDLSQYIL............................................................................................... 455

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.