current user: public

If you have questions about the server, please let us know.

Query: IDP91310 putative translocator protein PopB [Vibrio parahaemolyticus RIMD 2210633] VP1657 [Vibrio parahaemolyticus RIMD 2210633], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .
# Score Template Links and tools%idFirst MSSIALDRTQTQVYIPESGQTTLENVQKTASTATPSVTVENVKSRDADTLNTGRVKVQLDAPNAAVSDKVTDLTLKAMAQLQKIVDTIAKALHAVADQTGSIAVKIIAGSADDFEVELAAITDKLKSAQNELKIQEVKVAKAKHEQEMAENQEKIKESEAAAKEAQKSGLAAKIFGWISAVVSIVVGAIMVATGVGAAAGALMIAGGVMGAVSMALQEPAVQDALKEAGVNVDVLNKVVMALEIAVAVIGAIVTFGGAAAGGIAKLAAKSASKIAQKVTDIATKAAANMAKVADMGSKAATTTAKAIRYGAETVDLTVNIGKGATDSVHAANNANVTEIQADITDLRAKMTLSQAVIDKLKEEIGKLMEDFQELMSIIMQMIQAKSETMQTVLSRPATVLast
1 -108.000IDP91310 putative translocator protein PopB [Vibrio parahaemolyticus RIMD 2210633] VP1657 [Vibrio parahaemolyticus RIMD 2210633]  ali  100  1MSSIALDRTQTQVYIPESGQTTLENVQKTASTATPSVTVENVKSRDADTLNTGRVKVQLDAPNAAVSDKVTDLTLKAMAQLQKIVDTIAKALHAVADQTGSIAVKIIAGSADDFEVELAAITDKLKSAQNELKIQEVKVAKAKHEQEMAENQEKIKESEAAAKEAQKSGLAAKIFGWISAVVSIVVGAIMVATGVGAAAGALMIAGGVMGAVSMALQEPAVQDALKEAGVNVDVLNKVVMALEIAVAVIGAIVTFGGAAAGGIAKLAAKSASKIAQKVTDIATKAAANMAKVADMGSKAATTTAKAIRYGAETVDLTVNIGKGATDSVHAANNANVTEIQADITDLRAKMTLSQAVIDKLKEEIGKLMEDFQELMSIIMQMIQAKSETMQTVLSRPATV 399
2 -82.400IDP04697 gene: yopB; secreted effector protein [Yersinia pestis CO92] YPCD1.29c [Yersinia pestis CO92]  ali follow..  32  3.ALITHDRS-----TPVTGSLLPYVETPAPAPLQTQQVAGELKDKN---GGVSSQGVQLPAPLAVVASQVTEGQQQEVTKLLESVTRGAAGSQLISNYV-SVLTKFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGIASKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASGVIGMANMAVKQ-AAEDGLISQEA-MKILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLVAKGAEFSAKVAQISTGISNTAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKADMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLHNLAGRPHTV 401
3 -19.200IDP93853 secretion system effector protein SseC [Yersinia enterocolitica subsp. palearctica Y11] YP_006007025 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  20  81.....................................................................................................SLDNPGETDIQQIMSMVSSLNLGLFSNLCKSISQQMERATDVQTKRVAEYQQQIDKAVEQADKAKKAGIFTAVFDWIVGAVEVVYGALKVAEGV--ASGVAYLAAGTAGLVKAAAETAMLLGASKEKQEVIDVAGKVQLGCECFAMAIDIFQAARAINAARTVTKGASLKSGASEALTDAIKRGASGEIEAEKFGKDVSQQVSRNITEMVEVGNMTSAAAKQAAKAEIALVRNITKSFTHEGIEKLVGGVAKKLAQDAIKKGITLTAEQFSQ.......................... 373
4 -17.400IDP91469 putative secreted protein EspD [Vibrio parahaemolyticus RIMD 2210633] VPA1362 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  18  65....................................................................................................................QVADSVSGSGQEKVATKKGLIELQKDSQIAMLNERASQLEEQKKAQQTQGILGKIAMAFGFIAAIIMAPFNPVMAAVMIGGMVASLVI-------------PKIADEIMKSAGVDEKTRGIVKMGLDIAIGLGTMLLSFNAGIASSAGKAIAGGAAKAAALVKR-GVDAAKTLKSFTAISSKAGGLAEKIRKSAQPLLD-ASSVGSNVTSLVSTGYGIKTADISKQMEVNQAKQDELQTRIEQVLKMLDQAMRSVAHSFETLIKTNEDYRSFSKTMTS..... 346
5 -16.900IDP04225 gene: ipaB; IpaB, secreted by the Mxi-Spa secretion machinery, required for entry into epithelial cells [Shigella flexneri] CAC05803 [Shigella flexneri]  ali follow..  16  255....................................................................................................................TFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVGCVGKILGALLTIVSVVAGASLALAAVG----ALMVTDAIVQAAT--ALNPIMKAVIEPDSKKAKMIGSILGAIAGALVLVAAVVLVATVGKQAAAKLAENIGKIIGKTLTDLIPKLKNFSSQLDDLITNAVARLNKFLNQAVLLGESVNSATQAGGSVASAVFQNSASTNLADLTLSKYQVEQLSKYISEAIEKFGQLQEVIADLLASMSNSQANRTDVAKAILQQTTA. 580
6 -12.300IDP91309 putative translocator protein PopD [Vibrio parahaemolyticus RIMD 2210633] VP1656 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  15  109....................................................................................................................SLLTLLYQVSKLSREQQVLQREIAVEANVASLQSQAAELNNS---------------------ASAMIAMAVV---------SGVLAGATAIIGALGSFKAGKEIKTE---------------MASNNVLKTQKAGFDQVEELMNN-GNLSKTQQDQVKRAHSLAKDSIADTTAQLTSGGRKFDKLMSS--------NQAKNAILQALGQMANSASNVEQTKAQARSKDDEVQATRAQAAKQKADENIGFQEGLLKELRELFRSISDSQNQAWRASIP..... 332
7 -8.220IDP93886 methyl-accepting chemotaxis protein [Yersinia enterocolitica subsp. palearctica Y11] YP_006007026 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  15  32..........................................................................................................IIADLTDIIFKMVGLMKQMRDLLNAYNQKQQILGWNIQVNAMSNKREAIDKTASAAIASGACSIVSGFISGTGAGASLKLG--DIATHIGSAVG--QLSAGSGKLAEGDMTRNAELFNMA------------------------------SGLQSSSAQTYNKNSSELADKVGEVRQNMKEFANTLTNLICQIATAA................................................................................................ 194
8 -7.520IDP04224 gene: ipaC; IpaC, secreted by the Mxi-Spa secretion machinery, required for entry into epithelial cells [Shigella flexneri] CAC05802 [Shigella flexneri]  ali follow..  11  117.....................................................................................................................................LSALRTAETKLGSQLSLAFDATKSAAENIVRQGLAALSSSITGAVTQVGITGIGAKKTHSGISDQKGA--LRKNLATAQSLEKELAGSKLGLNKQI-------------DTNITSPQTNSSTKFLGKNKLAPDNISLSTEHKTSLSSPDISLQDKIDTQRRTYELNTLSAQQKQNIG----RATMETSAVAGNISTSGGRYASALEEEEQLISQASSKQAEEASQVSKEASQATNQLIQKLLNIIDSINQSKNSAASQIAGNIRA. 363
9 -6.240CPX_91673_04225 Complex of CD44_HUMAN with IPAB_SHIFL [Undefined organism]  ali follow..  17  901INQIQTRLSELDPESPEKKKLSREEIQLTIKKDAAVKDRTLIEQKTLSIHSLTDKSMQLEKEIDSFSAFSNTASAEQLSTQQKSLT---------------------LASVTQLMATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRMGCVGKILGALLTIVSVVAGASLALAAVG----ALMVTDAIVQAATKAVIEPLIKEGLGVDSKKAKMIGSILGAIAGALVLVAAVVLVATVGKQAAAKLAENIGKIIGKTLTDLIPKLKNFSSQLDDLITNAVARLNKFL-ISKQIISTHLNQAVLLGESVNSATQAGGSVASASASTNLADLTLSKYQVEQLSKYISEAIEKFGQLQEVIADLLASMSNSQANRTDVAKAI 1317
10 -6.170IDP91610 gene: ECs4554; EspB protein [Escherichia coli O157:H7 str. Sakai] BAB37977 [Escherichia coli O157:H7 str. Sakai]  ali follow..  14  51....................................................................................................................EIQKLLGKMVTLLQDYQQKQLAQSYQIQQAVFESQNKAIEEKKAAATAALVGGIISSALG-FAAMNNAAKGAGEIAEKASSASS--KAAGAASEVANKALVKATESVADVAE-------------------------------ASSAMQKAMATTTKAASRASGVADDVAKASDFAEDLADAAEKTSRINKLLNSVDKLTNTTAFVAVTSLAEGTKTLPVKSTHEVNEQRAKSLNFQQGNLELYKQDVRRTQDDITTRLRDITSAVRDLLEVQNRMGQ..... 306

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35