current user: public

If you have questions about the server, please let us know.

Query: IDP91365 dissimilatory sulfite reductase, gamma subunit [Vibrio vulnificus CMCP6] VV1_2710 [Vibrio vulnificus CMCP6], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
1 -77.200IDP91365 dissimilatory sulfite reductase, gamma subunit [Vibrio vulnificus CMCP6] VV1_2710 [Vibrio vulnificus CMCP6]  ali  100  1MFVYNGKQIETDAQGYLLDHTQWEEGMIEILAEQEGIELTDAHLEVIHFVRDFYEEFNTSPAVRMLVKAMEKSHGPEKGNSKYLFKLFKEGPAKQATKLAGLPKPAKCL 109
2 -76.800IDP02808 gene: yccK; sulfurtransferase TusE [Salmonella typhimurium LT2] STM1084 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  61  1MLIFEGKEISTDSEGYLKETTQWSEALAVAIAANEGIELSAEHWEVVRFVREFYLEFNTSPAIRMLVKAMANKFGEEKGNSRYLYRLFPKGPAKQATKIAGLPKPVKCI 109
3 -8.960IDP01117 LexA repressor BA_3754 [Bacillus anthracis str. Ames]  ali follow..  19  3.....................................KLTKRQQDILDFIKLKVQEKGYPPSVREIGQAVG--LASSSTVHGHLSRLEEKGYIRR.............. 58
4 -8.840IDP00210 gene: lexA; LexA repressor YPO0314 [Yersinia pestis CO92]  ali follow..  19  3.....................................ALTTRQQEVYDLVRDHLAQTGMPPTRAEIAQRLG--FRSPNAAEEHLKALARKGVIEI.............. 58
5 -6.120IDP90943 DNA replication intiation control protein YabA [Bacillus anthracis str. Sterne] BAS0032 [Bacillus anthracis str. Sterne]  ali follow..  16  16......SSMEEQIGHLYKQLGELKQHLAELLEENQHIKMENEN------LRHRFEEVQIKEKQKTQKRKEVKPKTDIGEGYDNLARLYQEGFHICNLHYGSVRKEGDCL 112
6 -6.110IDP02662 gene: menF; menaquinone-specific isochorismate synthase [Listeria monocytogenes EGD-e] lmo1676 [Listeria monocytogenes EGD-e]  ali follow..  15  268LLAVNGDEIHSSCAGSTERGATEEADEALGNALLKDAKNLREHSYVVQMMEETLKPFTTGRDIQHLYMNITAKKKPDVSMLEMVKALHPTPA------LGGLPQKMG.. 381
7 -5.810IDP92650 gene: cobB; deacetylase of acs and cheY, regulates chemotaxis [Escherichia coli str. K-12 substr. MG1655] b1120 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  15  6VLVLTGAGISAESRTFRAADGLWEEHRVEDVATPEGFDRDPE-QAFYNARRRQLQQPEIQPNALALAKLQDALGDRFLLVTQNIDNLHERAGNTNVIHMHGELLKVRCS 119
8 -5.800IDP01436 menaquinone-specific isochorismate synthase VC1976 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  237LYLRHGQNLETEAAGTIGRGANATQDMELAHWLTHDSKNLNENQLVVEDIIESLAPHAEQRKVQHLKKRIDAQLKSGVNGVQLLGVLQPTAA------VAGLPRQAA.. 350
9 -5.770IDP91422 gene: secA; preprotein translocase subunit SecA [Vibrio vulnificus CMCP6] VV1_0569 [Vibrio vulnificus CMCP6]  ali follow..  13  327IVNEDGEVVIVDETGRTMPGRRWSEGLHQAVEAKEGVKIQNENQTLASITFQNYFR---------LYEKLSGMTGTADTEAFEFQSIY..................... 406
10 -5.730IDP00925 gene: entC; isochorismate synthase STM0595 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  199LLRKEGERFSSLPAGSARRQPDDVLDREAGNRLLASQKDRHEHELVTQAMKQILRDR-TTPTLWHLGTPFEGKANAGENALTLACLLHPTPA------LSGFPHQVA.. 312

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.