current user: public

If you have questions about the server, please let us know.

Query: IDP91394 hypothetical protein VV1_1133 [Vibrio vulnificus CMCP6] VV1_1133 [Vibrio vulnificus CMCP6], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst MKPQACPQCGLRYQCLCDQFPSLQSEVALVLLMHPNEVERETNTGKLLHWCRLPVRQFVWQRAAPPQALLDLLSDAQFMPVVLYPSEQSITLTQIKERAQQTQRQPLFIILDATWQEARKMLNKSEWLKALPQLALHGDSASNYQLRRNQQQGNLCTLEIAAELVKQLGEAHNATSMTELLRHYLAAFHADRSGHALKSEPLast
1 -93.200IDP91394 hypothetical protein VV1_1133 [Vibrio vulnificus CMCP6] VV1_1133 [Vibrio vulnificus CMCP6]  ali  100  1MKPQACPQCGLRYQCLCDQFPSLQSEVALVLLMHPNEVERETNTGKLLHWCRLPVRQFVWQRAAPPQALLDLLSDAQFMPVVLYPSEQSITLTQIKERAQQTQRQPLFIILDATWQEARKMLNKSEWLKALPQLALHGDSASNYQLRRNQQQGNLCTLEIAAELVKQLGEAHNATSMTELLRHYLAAFHADRSGHALKSEP 201
2 -7.080IDP95198 gene: wagK; WagK [Acinetobacter baumannii] AHB32695 [Acinetobacter baumannii]  ali follow..  14  3.......................NNKIALVVIVYGKALEDAMTIQSLLSFEEKLEHLLIVNNGPAVIDENSAVLTQKHHHVVLENQVQNKPLSWIYNDFIQQYDADYYVLFDDD-EYQNMLFTAQDIDIELPKIISMSDKAQYYPLVDGVIEQKDGIISNAKEVFSIGSGLVISKGVKEYF.................... 167
3 -6.510IDP00843 hypothetical protein SACOL1859 SACOL1859 [Staphylococcus aureus subsp. aureus COL]  ali follow..  10  248........................LFYPYLLVQGEAGIGKSHLLAHLSKKLRDENHLFLGQFFTKNEDPWHQILND------LEVTNSVDNFLRSISNKAKETKKRAFIIIDALWGN--YFQSFINHIKKYSNIALIFSIRTPF-EDVILPKNAIQDNNIVVFQHEGFSKEENYNPIVSFCDFYGLELPKLPILNPEFNNP 426
4 -6.460IDP05523 esterase [Clostridium difficile 630] CD2204 [Peptoclostridium difficile 630]  ali follow..  7...................................................................KFKSKYTGGETDIIVILPVANGKELFSGKEIYDFEGKFKTLYLFHGSWTNVEHYAKNKNIALVIPR-ELPKFVRAIFPLSDKREDNFVAGMSALKLALSKPKEFSAVASFSGSPDM.................. 156
5 -6.040IDP06144 hypothetical protein jhp1366 [Helicobacter pylori J99] NP_224084 [Helicobacter pylori J99]  ali follow..  12  2....RCLTCLKLSFC-CKILQEQGLNTPLYGIAIDDKIKSFYSHSAALLKGFCQGNLKATYGRLRANNAVSYAGKSL-----------EFRANNPRNFTFRGDESLDYFLLDTTLKEALKYLKTL--IKAHFAIALCSADE............................................................ 191
6 -5.800IDP92101 protein phosphatase 2C, putative [Toxoplasma gondii ME49] TGME49_032340 [Toxoplasma gondii ME49]  ali follow..  13  341.PVIITANAGDSRGVICRGGKAFPLSHD-----HPDEKKRIVAAGGYVTNGRVDGNLNLSRAVGDLFYKQTKELPAKAQRITAFPDVRITRITPEDE----------FVIIDGIWD-----GKSNQEAVDFVREKLQAAGNVT---SATLKQVCEDLCDECLAEDPLQSEGHGCDNMTCLIVELSSCLKSAATATADARI. 522
7 -5.570IDP93861 PTS system, N-acetylgalactosamine-and galactosamine-specific IIA component [Yersinia enterocolitica subsp. palearctica Y11] YP_006004700 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  13  2..........................LSIILSGHGGFATGLEKAMKQILGEQPQVIAIDFPESSSTALLTAQFEE---------------------ALANLEQREGLIFLTDGTFRVASTLAMQKANREVITGVNLQLLLEMVLERDGLSSQEFRLQARGLTSLVDEMGRYREAVAVEEGI.................... 144
8 -5.510IDP01784 gene: ttrA; tetrathionate reductase complex subunit A [Salmonella typhimurium LT2] STM1383 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  73IAMTQCFGCW------CGIRARVNADGKVIRIA--GNPYHPLSQEHPIDSSVPFSEAMEQLAGESGLDARSTACARGATLLESLYSPLRLLEPMKRVGKRGEGKWQRI-----SFEQL---------------------------------------IEEVVEGGDLFGEGHVDGLR........................ 199
9 -5.380IDP01459 flavodoxin VC2420 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  1..........................MKIGLF-YGSSTCYTEMTAEKIRAILGEELVDI--------------------------------HNVKESPLTLMSDYDLLLLGISTWDFGEIQEDWSAVWDHIGGVSLKNKYVALFGLQEGYGEWYLDAMGLLHDQIKKSGANLLGY.......................... 118
10 -5.300IDP93929 ATP synthase SpaL [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007702 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  128NLRRPVTTPLVTGVRAIDGLLTCGQGQRMGIF--AAGSGKTSLMSMIMNHAVADICVIIGERGREVTEFIHELQTSPRAAQTILVYATSDSPAVERCNAARDQGKDVLLFVDSMTRYARALRDVALAAGELPA-SVFEQLPLLLERPGALQHGSITAFYTV-----LLESEEESDPIGDEIRSIIDGHIYLSAQLAGRGYP 340

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.