current user: public

If you have questions about the server, please let us know.

Query: IDP91469 putative secreted protein EspD [Vibrio parahaemolyticus RIMD 2210633] VPA1362 [Vibrio parahaemolyticus RIMD 2210633], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .
# Score Template Links and tools%idFirst MKTSLVNIAENQESLWGQANKEIEKKQNQPQQQAESGSVVPGQPLPGSSVSLNDLWRSIRESMKQVADSVSGSGQEKVATKKGLIELQKDSQIAMLNERASQLEEQKKAQQTQGILGKIAMAFGFIAAIIMAPFNPVMAAVMIGGMVASLVIPKIADEIMKSAGVDEKTRGIVKMGLDIAIGLGTMLLSFNPAGIASSAGKAIAGGAAKAAALVKRGVDAAKTLKSFTAISSKAGGLAEKIRKSAQPLLDKIQEFAKGGQMSAARIGQASSVGSNVTSLVSTGYGIKTADISKQMEVNQAKQDELQTRIEQVLKMLDQAMRSVAHSFETLIKTNEDYRSFSKTMTSIHMLast
1 -151.000IDP91469 putative secreted protein EspD [Vibrio parahaemolyticus RIMD 2210633] VPA1362 [Vibrio parahaemolyticus RIMD 2210633]  ali  100  1MKTSLVNIAENQESLWGQANKEIEKKQNQPQQQAESGSVVPGQPLPGSSVSLNDLWRSIRESMKQVADSVSGSGQEKVATKKGLIELQKDSQIAMLNERASQLEEQKKAQQTQGILGKIAMAFGFIAAIIMAPFNPVMAAVMIGGMVASLVIPKIADEIMKSAGVDEKTRGIVKMGLDIAIGLGTMLLSFNPAGIASSAGKAIAGGAAKAAALVKRGVDAAKTLKSFTAISSKAGGLAEKIRKSAQPLLDKIQEFAKGGQMSAARIGQASSVGSNVTSLVSTGYGIKTADISKQMEVNQAKQDELQTRIEQVLKMLDQAMRSVAHSFETLIKTNEDYRSFSKTMTSIHM 349
2 -17.400IDP91310 putative translocator protein PopB [Vibrio parahaemolyticus RIMD 2210633] VP1657 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  18  117................................................................ELAAITDKLKSAQNELKIQEVKVAKAKHEQEMAENQEKIKESEAAAKEAQKSGLAAKIFGWISAVVSIVVGAIMVATGVGAAAGALMIEPAVQDALKEAGVNVDVLNKVVMALEIAVAVIGAIVTFG-GAAAGGIAKLAAKSASKIAQKVTDATKAAANMAKVADMGSKAATTTAKAIRYGAETVD------------------TVNIGKGATDSVHAANNANVTEIQADITDLRAKMTLSQAVIDKLKEEIGKLMEDFQELMSIIMQMIQAKSETMQTVLS... 394
3 -16.400IDP04697 gene: yopB; secreted effector protein [Yersinia pestis CO92] YPCD1.29c [Yersinia pestis CO92]  ali follow..  14  109................................................................ELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGIASKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASISQEAMKILG--------ILTAIEVALTVVSTVMTFG-GSALKCLANIGAKLGANTASLVAKGAEFS------AKVAQISTGISNTVGSAVTKLGGSFLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKADMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLHNLAG... 396
4 -12.200IDP04225 gene: ipaB; IpaB, secreted by the Mxi-Spa secretion machinery, required for entry into epithelial cells [Shigella flexneri] CAC05803 [Shigella flexneri]  ali follow..  14  253..............................................................MATFIQLVGKNNEESLKNDLALFQSLQESRKTEMERKSDEYAAEEELNRVMGCVGKI-TIVSVVAAAFSGGASLALAAVGLALMVTDAILSDAFTKMLEGLGVDSKKAKMIAIAGALVLVAAVVLVATVGKQAAAKLAENIGKIIGKTLTDLIP--------KFLKNFSSQLDDLITNAVARLNKFLGAAGDEVISKQIISTHLNQAVLLGESVNSATQAGGSVSASTNLADLTLSKYQVEQLSKYISEAIEKFGQLQEVIADLLASMSNSQANRTDVAKAILQ... 576
5 -5.870CPX_91673_04225 Complex of CD44_HUMAN with IPAB_SHIFL [Undefined organism]  ali follow..  17  942IEQKTLSIHSKLTDKSMQLEKEIDSFSAFSNTASAEQLSTQQKSLTG-----------LASVTQLMATFIQLVGKNNEESLKALFQSLQESRKTEMERKSDEYAEVRKAEELNRVMGCVGKILG-IVSVVAAAFS-ALAAVGLALMVTAVIEPLIKTKMLEGLGVDSK---KAKMIGSILGAIAGALVLVAAVVLVATVGK---QAAAKLAENIGKIIGKTLT-KFLKNFSSQLDDLITNAVARLNKFLGAAGDEVISKQIISTHLNQAVLLGESVNSATQAGGSVASAVFQNDLTLSKYQVEQLSKYISEAIEKFGQLQEVIADLLASMSNSQANRTDVAKAILQ... 1319
6 -4.810IDP04147 gene: hofC; putative type II secretion system protein [Yersinia pestis CO92] YPO3427 [Yersinia pestis CO92]  ali follow..  10  106............................................................AQGQSLSEVMEQYPHVFPRLYPPVVAVELTGNLEQCCTQLVHHQERQQNLHKK------------VIKALKYPVVVCIVALVVSVIMLVMVLPEFA-QIYQSFDTPLPGLTASLLWLSLALIIAIVCIGYFYTLRKKSRWQCLSQIFQTLAITQQAGLPLSAGLDAAARSIHN---------YNYQQALRCIQKQISQGIPLYTTLNQHPLFPAICQQLIRVG---ESGSQDVLLKLACWHQQQTQNLADNVTQMLEPLL............................. 372
7 -4.780IDP02299 gene: nuoD; NADH dehydrogenase subunit D [Francisella tularensis subsp. tularensis SCHU S4] FTT0034 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  34......................................................................................VRADPHVGLLHRGTEKLAEFKPYNQSIGYMDRLCNEHAYVMAI-LLQLEVPERAKYIRVMFAEM--TRILNHLLWVAACGIDLREDLFDCYEAVSGARMHAAYFRPGGVARDLPTQMPQYQKTRFTSKRKAKKLNE------PRQGSMLDFLDHFVVDFEKSLDEIDTLLTDNRLWKQRTVDIGTVTAERAKELGTGPMLRGSGVAWDLDIPIGANGDCYDRYLVRMAEMRESNKLIKQCVDWL................... 303
8 -4.110IDP00457 hypothetical protein YPO0570 YPO0570 [Yersinia pestis CO92]  ali follow..  14  15........................................................KSLADTLEEVLQSSTDKPKAELDKLRAKAESALKDTRVRLSETSDKIAAQTKEIADK-------------NYVHDNPWTGVGIGAAVGVVLGVLL...................................................................................................................................................................................................... 98
9 -4.070IDP02076 putative methyl-accepting chemotaxis protein [Salmonella typhimurium LT2] STM3216 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  252............................................LMAMKTRLLDIVQEVQNGSESISTAAAQIVAGNQD-----LAARTEEQASSVEETAASMEQITATVKNTADHTSEATKLSAGAASVVKNNGEMMNQV-TQKMRV---INDTANRMSDIINIID------------SIAFQTNILALNAAVEAARAGRGFAVVAGEVRQLAQKSASSASEIRNLMHLVEKASALINGMVDNVEEMDVILREIGQASREQTDGISQINSAIGLIDAATQQNSCL--------VEESVAAAASLNEQALHLKELVN................................ 509
10 -4.070IDP00893 putative cytoplasmic protein STM4002 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  19  1.................................................MSLPQKSKVMHIARTLTGSTTQDEGQERQEAKTQ--DCQEDKRPETLVKGNGNNMECSRLREKQG........................................................................................................................................................................................................................................... 63

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35