current user: public

If you have questions about the server, please let us know.

Query: IDP91474 putative targeted effector protein YopP [Vibrio parahaemolyticus RIMD 2210633] VPA1346 [Vibrio parahaemolyticus RIMD 2210633], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MKVNLEQNHYYEQRGGSDLREQLSSYIDLMDDAIRQGKQLPKDTAAANDIALMDDFIAIANQKKEGLNAHFFRSPLDMVNYVKSLIPSEDTTARFVVNMGSGGIHCIAVDCAIKNGKCSLIGIDPVTMNSLGASMLAIRLQSVCKRELPETSLVIMETDMQRSQGECLMFSLFLVKKMHKECDEFQSLHDKNINRELPLTQGLLVSVKDADSLLPPSLMKHTQSPNRLQKYLETRPEAMNCVVNKKGDTLKTRQQRHITTIELDEKTVSYSNSIEQKRIKEAKGLLNNLLast
1 -110.000IDP91474 putative targeted effector protein YopP [Vibrio parahaemolyticus RIMD 2210633] VPA1346 [Vibrio parahaemolyticus RIMD 2210633]  ali  100  1MKVNLEQNHYYEQRGGSDLREQLSSYIDLMDDAIRQGKQLPKDTAAANDIALMDDFIAIANQKKEGLNAHFFRSPLDMVNYVKSLIPSEDTTARFVVNMGSGGIHCIAVDCAIKNGKCSLIGIDPVTMNSLGASMLAIRLQSVCKRELPETSLVIMETDMQRSQGECLMFSLFLVKKMHKECDEFQSLHDKNINRELPLTQGLLVSVKDADSLLPPSLMKHTQSPNRLQKYLETRPEAMNCVVNKKGDTLKTRQQRHITTIELDEKTVSYSNSIEQKRIKEAKGLLNNL 289
2 -89.400IDP00447 gene: yopJ; targeted effector protein YPCD1.71c [Yersinia pestis CO92]  ali follow..  32  8..INISGGLSEKETSSLISNEELKNIITQLETDISDGSW-FHKNYSRMDVEVMPALVIQANNKYPEMNLNLVTSPLDLSIEIKNVIENGVRSSRFIINMGEGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRTKTAIERY-PDCHFSMVEMDIQRSSSECGIFSFALAKKLYIERDSLLKIHEDNIKGILS-DGKNPLPHDKLDPYLPVTFYKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIVNRFDNNKSIVD----GKELSVSVHKKRIAEYKTLLK.. 287
3 -17.400IDP90101 gene: sseL; deubiquitinase [Salmonella typhimurium LT2] STM2287 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  137...............................................LSSDELAAATQGLVQESPLLSVNY-TTKENILSTQLLEKIAQSGLSHNEVFLVNTGDHWLLCLFYKLAEKIKCLIFNTYYDLNENTKQEIIEAAKIAGISESDEVNFIEMNLQNNVPNGCGLFCYHTIQLLSNAGQ.......................................................................................................... 278
4 -14.900IDP06461 gene: I7L; I7L [Monkeypox virus Zaire-96-I-16] NP_536495 [Monkeypox virus Zaire-96-I-16]  ali follow..  10  230.............................................................................................RFVMFGFCYLSHWKCVIYDKKQC--LVSFYDSGGNITEFHHYNNFYFYSFSDGFNTNHRGCINVEVNQLLESECGMFISLFMILCTRTPPKSFKSLKKVYTFFKFLAD---------------------KKMTLFKSILFNLQDLSLYITETDNAGLKEYKRMEKWTKKS----NVICDKLTTKLNRIVDD..... 421
5 -4.310IDP90427 hypothetical protein [Chlamydia trachomatis D/UW-3/CX] CT_847 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  10  19.......................................................................................................................................................STLIEPASIEINKKSAMYFCITVMLKLSVATTDYSHIMAVLQENTLEQQRKTKELINVSLLYVPDLIKKNGSDNEYTNHSTIQAFQTSNQQITANRELIQQELSAAQQRAQANQKSVNATSTESMKILQAVSALLTSL 157
6 -4.240IDP00182 M48 peptidase family protein YPO0398 [Yersinia pestis CO92]  ali follow..  137.......................EHSLEWLQQSGFKPSALPAERQEAIQQLFLQVMPPQMRQERTPLKLVLMTAPTTANAFMDDLIKLTTSDDALAAVMLHEMGHHASMQMVVRSSLVALTFMWMTGDVNGIGDTLLQSAAFIHEMQFSR------TIESEADS-----WAIAEMQREKRSLLAMEDIYHALQQTTTPEEAETRAGIPEWLSSHPDMPARLDVIRAAREKMAQE....................................................... 348
7 -3.920IDP05090 putative flagellar biosynthesis protein [Clostridium difficile 630] CD0230 [Peptoclostridium difficile 630]  ali follow..  11  4............................................................................................................................................................................DLKVIIYEEKKIISNMMELLKEQFDYIIEKDLENLNRLNPKLEDISRELASIEIKRRQLLGDDVSISEVVENSNDEYLKEIYIDLKHILALAKNQQESNDSLIKKELIFTKKMINFI 120
8 -3.870IDP02252 gene: tsr2; putative methyl-accepting chemotaxis protein [Yersinia pestis CO92] YPO1229 [Yersinia pestis CO92]  ali follow..  10  315LTQRLPIEGRDEVAQIARSFNQFADKLSLVMAQIRGTSESVRVAANEIAAGNQD-LSGRTESAAASLQ-QTSAALEQISATVAQSASAARQANNAVFS---------ASEDASRGGDVITKVITTMESIEKASGKIGD-ITSVIDGIAFQTNILALNAAVEAARAG---FAVGEVRILAQRSAQAAKEIKALIESTVSSVASGSSQVRQASNAMTDIVSSVSDVTTIMSEITNAADEQMRHEINSAVAQLDTMVQQNAALVQ---ESTAASAALQAQAADLTDTV.... 590
9 -3.830IDP06485 gene: A23R; A23R [Monkeypox virus Zaire-96-I-16] NP_536560 [Monkeypox virus Zaire-96-I-16]  ali follow..  3........................................................................TSTSSSQSLIPLPMSKKDYSSEIICAFDIGAKNPARTVLEVKDNSVRVLDISKLDWSSDWERRIAQDLSQY------EYTTVLLERQPRRSPYVKFIYFIKGFLYHTSAAKVICVSPVMSGNSYRDRKK---------------------RSVEAFLDWMDTFGLRDSVPDRRKLDDVADSFNLAMRYVLDKW-----NTNYTPYNRCKYRNYIKKM 187
10 -3.690IDP00451 gene: yopT; Yop targeted effector YPCD1.20 [Yersinia pestis CO92]  ali follow..  147IRSHAQGQSGRKGKFQIDTLYSIKQLQIDGCKADVDQDEVTLDWFKKNGISERMIERHCLLRPVDVTGTTESEGLDQLLNAILDTHGIGYGYKKIHLSGQMSA-HAIAAYVNEKS---GVTFFDP--NFGEFHFSDKEKFRKWFTNSFWGNSMYHYPLGVGQR------FRV..................................................................................................................... 314

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.