current user: public

If you have questions about the server, please let us know.

Query: IDP91504 putative translocation protein in type III secretion [Vibrio parahaemolyticus RIMD 2210633] VP1670 [Vibrio parahaemolyticus RIMD 2210633], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .
# Score Template Links and tools%idFirst MRIKPSTDTPSTQPHSPQSPMPIDDHAMLQSRFERALKENPDQTKPQPNETNNQAALEAKKPFTENYSERSLASLHSTGSNQRKTAEKSAFAQNNDVVTENINNESDTSSPIALNTQDKMPSDMDANMKPDIRIPTTGDKKLPMEPSNKREKNADEQDAFERLVEDHDDSKTELAAAKTAESHESTQSPKDTKHIPTAGTKPNTVETVSDALASTLASTTVASATSASLASHPVTSTVHKTATKTEVNKHEGDSSLGFNSRNLKTPIPNDEHPKASQAERTLLDRAMLDSEKSNDKPMHQPVTTPITQGDVILKGISPPQPTQPTREVNQLIQQLVDKVYVALPTASNEKEVRLFLSEGQLKGGEIHIKLDSQGYSVTIRQEHALSIINQQARQDLAERLNRMGFEQPLRVSISEQTSQHGHTQQDQQQSRQQRSVYEEWQPEADQLast
1 -107.000IDP91504 putative translocation protein in type III secretion [Vibrio parahaemolyticus RIMD 2210633] VP1670 [Vibrio parahaemolyticus RIMD 2210633]  ali  100  1MRIKPSTDTPSTQPHSPQSPMPIDDHAMLQSRFERALKENPDQTKPQPNETNNQAALEAKKPFTENYSERSLASLHSTGSNQRKTAEKSAFAQNNDVVTENINNESDTSSPIALNTQDKMPSDMDANMKPDIRIPTTGDKKLPMEPSNKREKNADEQDAFERLVEDHDDSKTELAAAKTAESHESTQSPKDTKHIPTAGTKPNTVETVSDALASTLASTTVASATSASLASHPVTSTVHKTATKTEVNKHEGDSSLGFNSRNLKTPIPNDEHPKASQAERTLLDRAMLDSEKSNDKPMHQPVTTPITQGDVILKGISPPQPTQPTREVNQLIQQLVDKVYVALPTASNEKEVRLFLSEGQLKGGEIHIKLDSQGYSVTIRQEHALSIINQQARQDLAERLNRMGFEQPLRVSISEQTSQHGHTQQDQQQSRQQRSVYEEWQPEADQ 446
2 -37.000IDP93904 gene: yscP; putative type III secretion protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001004080 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  12  34..LLHNKDNRHPKEEPRRPVRPHDLGKKEGQKGDGLRAHAPLAATFQPGREVGLKPQHNHQNNHDFNLSPLAEGATNRKHLYQQDSRFDDRVESIINALMPLAPFLEGVTCETGTSSESPCEPFGHDELFVQQSPIDSAQPVQLNTKPTVQSLNPAADGAEVMIWSVGRDTLASIAKNQRDSRQKR---------LAEEPLPLHQEALPEVCPPAVSTTPDDHLVARWCATPVAEVAEKSARFPHKATVQSEQLDMTELADRSQHLTDGVDSSKDTIEPPRPEELLLPREETLPEMYSLSFTAPVITPGDHLLATMRATRLASVSEQLIQLAQRLAVELELR---GGSSQVTQLHLNLPELGAIMVRIAEIPGKLHVELIASRETLRILAQGSYDLLERLQRI---EPTQLDFQAS-------GDSEQESRQKRHVYEEWEAEE.. 453
3 -22.800IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali follow..  1571...VPAAAIPSVLLPADSEDGEKEQPKEKKKEKKEKKKKKDGETDAEPEEASAVLAPPPVPVPAAAIPSILLPTDGEDGEKEKTKEKKTEKKKEKHTEKKHKKKSEALPESETTAVVTVTPGEEDETSPLVPVPSSIASSEAPEPPASTRVTPAPEPKAKPGLSMGAALLAVRARSRLQRKHLAQQLSSSSSSEVSASSASSLSPSSSSSSDFAETRAKADALRARLQAAQARLAAARETEVSSSETESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMVSGVKAAYRRLEEENTRLAATRRRDDKLQRQVEAERERAVELLKEATRRAKEEKDLIARQPPPARDWS----------------------DTVVLSTPQIFVNSQAACAPFADS-GRDEGGRDEWYEVSDACSRRAESSNESRTTAGAKLRQQQLD..... 1985
4 -18.600IDP92738 gene: hsa; streptococcal hemagglutinin [Streptococcus gordonii] BAA97453 [Streptococcus gordonii]  ali follow..  1MFFKRQKGQYHEVERVTRFKLIKSGKHWLRAATSQFGLLRLMKGADISSVEVKVAEEQSVEKGGLNYLKGIIATGAVLGGAVVTSSSVYAEEEQALEKVIDTRDVLATRGEAVLSEEAATTLSSEGANPVESLSDTLSASESASANSVSTSISISESFSVSASASLSSSSSLSQSSSESASASESLSVSASTSQSFSSTTSSTQSSNNESLISSDSSNSLNTNQSVSARNQNARVRTRRAVAANDTEAPQVKSGDYVVYRGESFEYYAEITDNSGQVNRVVIRNVEGGANSTYLSPNWVKYSTENLG........................................................................................................................................... 307
5 -17.300IDP92737 platelet-binding glycoprotein [Streptococcus sanguinis SK36] YP_001034807 [Streptococcus sanguinis SK36]  ali follow..  1MFFKRQKGKYHEVERVTRFKLIKSGKHWLRAATSQFGLFRSMKGGGLSSIELKVTEEQVTDKKSGIDFLRGIVATGAVLGGAVVTSTTVHAEEGQALEKVIDTTDVLATRGETVLGEESSAAEAATATASSHTESESVSDTSSASASASVSASISASISASESMSQFSSASISASTSQAVSDSLSVSESLSVSSSTSDSVSASQPASTSASSKSESTVNSQSASSETNRSSTNNGSTSSSSETARVRKRRATDTTPPTITVPSDIIAYRGEEFEFYFEITDDSGQVKNIELSTFGKPLGLNWLEYSE........................................................................................................................................... 307
6 -17.200IDP91949 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007099 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  771...QGTTRTAGNKIPVTFMANAYLDNQSTYIVEVPILEKENQTDKPSILPQFKRNKAQENSKLDEKVEEPKTSEKVEKEKLSETGNSTSNSTLEEVPTVDPVQEKVAKFAESYGMKLENVLFNMDGTIELYLPSGEVIKKNMADFTGEAPQGNGENKPSENGKVSTGTVENQPTENKPADSLPEAPNEKPVKPENSTDNGMLNPEGNVGSDPMLDPALEEAPAVDPVQEKLEKFTASYGLGLDSVIFNMDGTIELRLPSGEVIKKNLSD................................................................................................................................................................................. 1036
7 -15.800IDP06012 membrane-attack complex / perforin domain-containing protein [Toxoplasma gondii ME49] EEB00555 [Toxoplasma gondii ME49]  ali follow..  11  1M-IGPTESRLQHIPFSTTRYLPIRSHVL-QSTVERIESPEALNEVPTKVERNEFTEKGDKTEQVLTAQADHKSLLEGRSVRLESTSTAPDDDFDFLFEDDTPKKPKSRVNKGTSSDETSPGDRSSGEGSSDSDSLLSVVHRTKGNATQANKNQTRITHPKSKAQHQKKVTKKQGIPGSDSLGTSSADFDFDIDSSSNTQADDSQRQSLGDSSALDLFGSDTGDTGDIFGFSNSSSDGGNAAANDGGLFSSSGMGPTGASDETSANPLGSILG.............................................................................................................................................................................. 277
8 -14.500IDP92613 RecName: Full=Serine-rich adhesin for platelets; AltName: Full=Staphylococcus aureus surface protein A; Flags: Precursor SAOUHSC_02990 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  10  1MSFHDSLANEKTRVRLYKSGKNWVKSGIKEIEMFKIMGLPFISHSLVSQDNQSISKKMTGYGLKTTAVIGGAFTVNMLHDQQAFAASDAPLTSELNTQSETVGNQNSTTIEASTSTADSTSVTKNSSSVQTSNSDTVSSEKSEKVTSTTNSTSNQQEKLTSTSESTSSKNTTSSSDTKSVASTSSTEQPINTSTNQSTASNNTSQSTTPSSVNLNKTSTTSTSTAPVKLRTFSRLAMSTFASAATTTAVTANTITVNKDNLKQYMTTSGNATYDQSTG........................................................................................................................................................................ 283
9 -13.700IDP05055 gene: fliK; putative flagellar hook-length control protein [Clostridium difficile 630] CD0253 [Peptoclostridium difficile 630]  ali follow..  258........................................................................................................................................................................................................................................................................................................................................SNVMDDSIKAIKHM--KTNDIQELTIKLRPKELGDMNIQLLKDGESMRAVVTVFNKDVFSINKNIADLKQHLELTN--KDVSVQMHSDNTNTSDTFDKAFEQQNRQN........... 364
10 -13.100IDP91679 gene: vIRF-3; vIRF-3 [Human herpesvirus 8] HHV8GK18_gp64 [Human herpesvirus 8]  ali follow..  139.................................QHSVRLEKHRRRPRPFVGENSDSSEEDHPAFCDVPVTQTGAESEDSGDEGPSTRHSASGVQPVDDANADSPGSGDEGPSTRHSDSQPPPADETTVHTDNVEDDLTLLDKESACALMYHVGQEMDMLMRAMCDEDLFDLLGIPEDVIATSQPGGDTDASGVVTEGSIAASAVGAGVEDVYLAGALEAQNVAGEYVLEISDEEVDDGAGLPPASRRRPVVGEFLWDDGPRRHERPTTRRIRHRKLRS........................................................................................................................................................................ 383
11 -13.100IDP05117 putative collagen-binding protein [Clostridium difficile 630] CD2831 [Peptoclostridium difficile 630]  ali follow..  10  22STIYPTVSYASELGENSQIQSGSTNSSTGEEKESDNKKPEQTPEKDKATDNKKPEQTPEEEKPTDNKKPEQTPEEDKSTDNKKPEQTPEGEKPIDNKKPEQIPEEDKSTDNKKSEQALEDEKPLDNKNTEKTPEEDNLLEDENLLKVLEEELNEENEDYGFVVKINNNTIETE................................................................................................................................................................................................................................................................................. 194
12 -12.000IDP90339 hypothetical protein CT050 [Chlamydia trachomatis D/UW-3/CX] CT050 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  10  235....NWLQDPTQAPTPEPDPDPEPAPEPEPDTSDSSGSGSENPADPAPTNPSDSNAQNNPTPSSNGATASIRKLAATTTTVPTDTEIAPAAEDPNLPNTTFSEKSPLWEEFFSFSDSSRSEMVIQKTGILTFSMQGTWENPSSSQTPSTDPISLELTVTPPTTDTPPESPPSPPEAPAPEATPSPTNNNLTASITKTFSRKYNLSATPSPTPTTTEPTTITKTLSLSSGQSCTLQIPVQATRSVLKLKYVNPNNNSSGGSSGSGGSSQPETTPTGITLQSFSWSLVLTPGEITKATSTPSTPSQP............................................................................................................................................. 536
13 -11.700IDP90350 hypothetical protein CT456 [Chlamydia trachomatis D/UW-3/CX] CT456 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  1MTNSISGYQPTVTTSTSSTTSASGASGSLGASSVSTTANATVTQTANATNSAATSSIQTTGETVVNYTNSASAPNVTVSTSSSSTQATATSNKTSQAVAGKITSPDTSESSETSSTSSSDHIPSDYDDVGSNSGDISNNYDDVGSNNGDISSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSDGAAAAALNSLRGSSYTTGPR........................................................................................................................................... 307
14 -11.500IDP02214 hypothetical protein Cj0041 [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0041 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  12  468......................................................................................................................................................................................................................................................................................................................................TPKETLQYFSQDLKEAVDQYKAPTKLSITLNPNNLGEVEVTLIQRGNNLHINFNSNANAMNLFIQNQAEFKNSLVNMG--TGLEMNFSDQGKREQNQNQGKNRSGYGFKDALDGKNESEK 587
15 -11.400IDP06528 gene: scm; collagen-binding MSCRAMM Scm (Fms10) [Enterococcus faecium DO] AFK60297 [Enterococcus faecium DO]  ali follow..  10  324.....PNEIFISDNGTDTTDTSDSTDTSTTSDSSDSSTSSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTSTTTSDSTDTSASSDSTDTTSTTSDSSDSSTTTSDSTDTSASSDSTDTSSTTSDSSDSSTSSDSTDTSSTTSDTRHASVSFSKTSSDNRTNFNLTNKTSNDNGNKSKRALPKTGSQSNNWITLAGVILLVIGLRITFMSYKKSKR................................................................................................................................................................. 603
16 -11.200IDP00768 superantigen-like protein SACOL0470 [Staphylococcus aureus subsp. aureus COL]  ali follow..  1MKMRTIAKTSLALGLLTTGAITVTTQSVKAEKIQSTKVDKVPTLKAERLAMINITAGANSATTQAANTRQERTP---KLEKAPNTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQAQTDMTPKYED................................................................................................................................................................................................................................................................................. 170
17 -11.100IDP92687 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus str. Newman] YP_001331559 [Staphylococcus aureus subsp. aureus str. Newman]  ali follow..  46..............GNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDG..................................................................................................................................................................................... 296
18 -10.300IDP06468 gene: A5L; A5L [Monkeypox virus Zaire-96-I-16] NP_536542 [Monkeypox virus Zaire-96-I-16]  ali follow..  28...DPDTKKDEAIEIGLKSQESYYQRQLREQLARDNMMVASRQPTQPLQPTIHITPQPVPTPTPAPILLPSSTAPVLKPRQQTNTSSDMSNLFDWLSADTDAPASTLLPALTPSNTVQDIISKFNKDQKMTTPPSTQPSQTLPTTTCTQ---QSDGSISCTTPTVTPLQPPIVATVCTPTPTGGTVCTTAQQNPNPGAASQQNLDDMTLKDLMSSVEKDMRQLQAET........................................................................................................................................................................................................................... 248
19 -10.200IDP06413 gene: vIRF-2; vIRF-2 [Human herpesvirus 8] YP_001129414 [Human herpesvirus 8]  ali follow..  150...EKALRRSKAQREAARKQAAAVATPTTSSAAEVSSRSQSEDTESSDSENELWVGAQGFVGRDMHSLFFEEPEPSGFGSSGQSSSLLAPDSPRPSTSQVQGPLHVHTPTDLCLPTGGLPSPVIFPHETQGLLAPPAGQSQTPFSPEGPVPSHVSGLDDCLPMVDHIEGCLLDLLSDVGQELPDLGDLLCETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSGQELPDLGDLSELLCETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSSFQASDNVDDFIDCIPP.......................................................................................................................................... 460
20 -10.100IDP00769 superantigen-like protein SACOL0472 [Staphylococcus aureus subsp. aureus COL]  ali follow..  2....KITTIAKTSLALGLLTTGVITTTTQAANATTPSSTKVEAPQSTPPSTKIEAPQSKPNATTPPSTKVEAPQQTANATTPPSTKVTTPPSTNTPQPMQSTKSDTPQSPTTKQVPTEINPKFKD................................................................................................................................................................................................................................................................................................................................. 122
21 -9.890IDP92699 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus USA300_TCH1516] YP_001574462 [Staphylococcus aureus subsp. aureus USA300_TCH1516]  ali follow..  47.....NQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQT..................................................................................................................................................................................................... 290
22 -9.610IDP92612 gene: gbs1529; Unknown [Streptococcus agalactiae NEM316] CAD47188 [Streptococcus agalactiae NEM316]  ali follow..  1MSQKTFGKQLTVVDTKSRVKMHKSGKNWVRTVMSHFNLFKAIKGRATVEADVCIQDVEKEDRLSSGNLTYLKGILAAGALVGGASLTSRVYADETPVVQEQSSSVPTLAEQTEVTVKTTTVQNHQDGTVSKNIIDSNSVSMSESASTSTSESVSMSMSGSTLTSVSESVSTSALTSASESISTSASESVSKSTSISEVSNILETQASLTDKGRESFSANQIVTESSLVTDAGKNASVSSLIEITKPKSELQTSKM............................................................................................................................................................................................... 255
23 -9.020IDP91101 superantigen-like protein [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00389 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  2....KITTIAKTSLALGLLTTGVITTTTQAANATTLSSTKVEAPQSTPPSTKIEAPQSKPNATTPPSTKVEAPQQTANATTPPSTKVTTPPSTNTPQPMQSTKSDTPQSPTTKQVPTEINPKFKDLRAYYTKPSLEFKNE.................................................................................................................................................................................................................................................................................................................. 137

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.