current user: public

If you have questions about the server, please let us know.

Query: IDP91677 gene: M1; matrix protein 1 [Influenza A virus (A/Puerto Rico/8/34(H1N1))] FLUAVs7gp1 [Influenza A virus (A/Puerto Rico/8/1934(H1N1))], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFKLast
1 -157.000IDP91677 gene: M1; matrix protein 1 [Influenza A virus (A/Puerto Rico/8/34(H1N1))] FLUAVs7gp1 [Influenza A virus (A/Puerto Rico/8/1934(H1N1))]  ali  100  1MSLLTEVETYVLSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK 252
2 -66.600CPX_91712_91677 Complex of HSP7C_HUMAN with M1_I34A1 [Undefined organism]  ali follow..  78  697..................................................PILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGAVTTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK 899
3 -54.800CPX_91702_91677 Complex of EZRI_HUMAN with M1_I34A1 [Undefined organism]  ali follow..  49  599............LSIIPSGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMGATTEVAFGLVCATCEQIADSQHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAGSSEQAAEAMEVASQARQMVQAMRTIGTHPSSSAGLKNDLLENLQAYQKRMGVQMQRFK 839
4 -7.960IDP92722 hypothetical protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0369c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  101......................LIGELYFFGSDDIKVDQKKGIEYIIKSA--YDIAQNQLGNLYV-------------------VGKVPGPNFAKAYKWYKLAIANGSLDARNAYLMNNERSFIENYPYCISIGRALIGDTYLNGL----LPKSPDFAIQWYQKAYE--------LDHISPVETGLARAYMAKGDKKLAYKYAREAIQ-QPYAPAFVVIADLTDNKVAKYAYLAEAVELYKNP......... 293
5 -6.790IDP06196 hypothetical protein HP0336 [Helicobacter pylori 26695] NP_207134 [Helicobacter pylori 26695]  ali follow..  11  2...................................................................................VGGGTVKKDLKKAIQYYVK---------------ACELNEMFGCLSLVSNSQINKQKLFQY--------------------------------LSKACELNSGNGCRFLGDFYENGKYVKKDLRKAAQYYSGCLILGYKQYAGKGVVKNEKQAVKTFEKA......... 123
6 -6.410IDP90083 hypothetical protein CGSHiII_00664 [Haemophilus influenzae PittII] ZP_01795671 [Haemophilus influenzae PittII]  ali follow..  10  5....................................................................................KTLLTTALFGASIFSFQSTAWADTPEQQFQQGLTAYEQSDYQTAFKLWLPMGYAQAQGGLGMMYERGLGVKQDDFKAVN--------------RKAAEQGDADAQLNLGAMYAIGHGVKQDGVEAQGNAKAQNGLGMMYRGRLGIKQDYFKAVKWYRKA......... 163
7 -5.850IDP00879 gene: yaeH; putative cytoplasmic protein STM0211 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  16  59...............................................................................................................................................................................................ADGIGQGYKEVQEISPNLRYVIDELDQICQRDRSELDLKRKILDDLRHLESVVANKISEIE 119
8 -5.690IDP91582 hypothetical protein CBU_0295 [Coxiella burnetii RSA 493]  ali follow..  10  33.....DLANAFIEASNREDISSTIAWKIREFFNDKPHEDCVNYFNYITQL--IPAKSYLLGMAY-------------------FLGVGVKQNTGRAKFFLRK-------------ATKAGEPNATVELFEIYSEEREKDQAQIYLNQALEKNHPRAQWLAANHSLEKEELENAKTLFQKAAIQGMPLAKHNLFLYQRQNLTPLFEAVQ-AGSVEALARLFAVCGNKYQIKEYAIYRFACFLEHEKYSKDAWG 263
9 -5.600IDP06550 set218a-004 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  17  1....................................................................................................................................................................MQKTSIVAFRRGYRLQWEAAQESHVEGMAKLNETAAAILGLVDGRRDVAAIIAMLNERFPEAGGVDDDVIEFLKIACQQKWITCR... 89
10 -5.300IDP04101 gene: minE; cell division topological specificity factor MinE [Clostridium perfringens ATCC 13124] CPF_2392 [Clostridium perfringens ATCC 13124]  ali follow..  9.....................................................................................................................................................................................................SRPTPKQVAKDRLKVILIHDRGELSDEVLDKIRLEILDVLSKYNEDVDITVTK.. 65

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.