current user: public

If you have questions about the server, please let us know.

Query: IDP91679 gene: vIRF-3; vIRF-3 [Human herpesvirus 8] HHV8GK18_gp64 [Human herpesvirus 8], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .
# Score Template Links and tools%idFirst MAGRRLTWISEFIVGALDSDKYPLVKWLDRSTGTFLAPAARNDVIPLDSLQFFIDFKRECLSKGLHPRDLLGSPITAFGKICTTSRRLRRLPGEEYEVVQGINCRRWRLLCAEVKECWWCVHARTHLHSGSSLWEILYQHSVRLEKHRRRPRPFVGENSDSSEEDHPAFCDVPVTQTGAESEDSGDEGPSTRHSASGVQPVDDANADSPGSGDEGPSTRHSDSQPPPADETTVHTDNVEDDLTLLDKESACALMYHVGQEMDMLMRAMCDEDLFDLLGIPEDVIATSQPGGDTDASGVVTEGSIAASAVGAGVEDVYLAGALEAQNVAGEYVLEISDEEVDDGAGLPPASRRRPVVGEFLWDDGPRRHERPTTRRIRHRKLRSAYYRVARPPVMITDRLGVEVFYFGRPAMSLEVERKVFILCSQNPLADISHSCLHSRKGLRVLLPKPDDNNTGPGDVNLLAAVLRSFASGLVIVSLRSGIYVKNLCKSTVLYHGNNPPKKFGVICGLSSRAVLDVFNVAQYRIQGHEHIKKTTVFIGGDPTSAEQFDMVPLVIKLRLRSVTCDDLast
1 -191.000IDP91679 gene: vIRF-3; vIRF-3 [Human herpesvirus 8] HHV8GK18_gp64 [Human herpesvirus 8]  ali  100  1MAGRRLTWISEFIVGALDSDKYPLVKWLDRSTGTFLAPAARNDVIPLDSLQFFIDFKRECLSKGLHPRDLLGSPITAFGKICTTSRRLRRLPGEEYEVVQGINCRRWRLLCAEVKECWWCVHARTHLHSGSSLWEILYQHSVRLEKHRRRPRPFVGENSDSSEEDHPAFCDVPVTQTGAESEDSGDEGPSTRHSASGVQPVDDANADSPGSGDEGPSTRHSDSQPPPADETTVHTDNVEDDLTLLDKESACALMYHVGQEMDMLMRAMCDEDLFDLLGIPEDVIATSQPGGDTDASGVVTEGSIAASAVGAGVEDVYLAGALEAQNVAGEYVLEISDEEVDDGAGLPPASRRRPVVGEFLWDDGPRRHERPTTRRIRHRKLRSAYYRVARPPVMITDRLGVEVFYFGRPAMSLEVERKVFILCSQNPLADISHSCLHSRKGLRVLLPKPDDNNTGPGDVNLLAAVLRSFASGLVIVSLRSGIYVKNLCKSTVLYHGNNPPKKFGVICGLSSRAVLDVFNVAQYRIQGHEHIKKTTVFIGGDPTSAEQFDMVPLVIKLRLRSVTCDD 566
2 -115.000IDP06413 gene: vIRF-2; vIRF-2 [Human herpesvirus 8] YP_001129414 [Human herpesvirus 8]  ali follow..  17  8......EWLTDFIIDALDSGRFWGVGWLDEQKRIFTVPGNRRERMPEGFDDFYEAFLEERRRHGLPEIPETETGLGCFGRLLRTANRARQERPFTI-YKGKMKLNRWIMTPRPYKGCEGCLVYLTQEPAMKNMLKALFGIYPHDDKHREKALRRSLRKKAQREAARKQAAAVATPTTSSAAEVSSRSQSEDTEEPEPSGFGSSGQSSSLLAPDSPRPSTSQVQGPLHVHTPTDLCLPTGGLPSPVIFPHETQGLLAPPAGQSQTPFSPEGPVPSHVSGLDDCLPETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSGQELPDLGDLSELLCETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSSFQASDNVDKLVPLVVEVYYFGEKVKTHFDLTGGIVICSQVPEASPEHIC-QTVPPYKCLLPRTAHC--SVDANRTLEQTLDRFSMGVVAIGTNMGIFLKGLLEYPAYFVGNASRRRIGKCRPLSHREIQQAFDVERHNRE--EGSRYASLFLGRRPSPEYDWDHYPVILHIYLAPFYHRD 680
3 -59.300IDP06369 gene: vIRF-4; vIRF-4 [Human herpesvirus 8] YP_001129412 [Human herpesvirus 8]  ali follow..  18  8......EWATLWIIDALENNKFPYFSWFDRNNLLFAAPAPAGSDIPPGWYSVYHAFDEECDRVYGPSPVVGQTVYGRFGRLLRGTRRAVVRNDLRYSDTFGGSYVVWQLVRTPFKNCTYCYGAAYGPEKLQRFIQCLLSGRAPQGAASERVYPFEPQPPSAPAPGYAKPSCYNWSPLAEPPATRPIRAPVWHPPVGHAVVPEVRTPLWIPWSSGGAPNQGLSHTQGGASATPSAGAPPTPEVAERQEPSSSGIPYVCQGDNMATGYRRVTTSSGALEVEIIDLTGDSDTPSTTVASTPLPVSGPRVFQPTVLYSAPEPAVNPEVSHLPTELERRECVCPGSGERPRVPLVSTYAGDRYAVGGYGPEQSLVPPRTPVSHSGPEKPPSKMFDPPDSQRVSFVVEIFVYGNLTLRREGDAGEAMLCSWPVGDTLGHLCQSFVPEL---LRIPRLTVPSPEQMEILNRVFEGLGHGFPIFCSMSGIYSRNATQVEGWWFGNPNSRYERILRSFSPRVPQQLFNTARYLATTAAPVTCGTVFFGASPASTENFQNVPLTVKIFIGSI--DS 909
4 -49.900CPX_91683_91679 Complex of MYC_HUMAN with Q9DUN1_HHV8 [Undefined organism]  ali follow..  87  453.............IVGALDSDKYPLVKWLDRSTGTFLAPAARNDVIPLDSLQFFIDFKRECLSKGLHPRDLLGSPITAFGKICTSRRLRRLPGEEYEVVQGINCRRWRLLCAEVKECWWCVHARTHLHSGSSLWEILYQHSVRLEKHRRRPRPFVGENSDSSEEDHPAFCDVPVTQTGAESEDSGDEGPSTRHSASGVQPVDDANADSPGSGDEGPSTRHSDSQPPPADETTVHTDNVEDDLTLLDKESACALMYHVGQEMDMLMRAMCDEDLFDLLGIPEDVIATSQPGGDTDASGVVTEGSIAASAVGAGVEDVYLAGALEAQNVAGEYVLEISDEEVDDGAGLPPASRRRPVVGEFLWDDGPRRHERPTTRRIRHRKLRSAYYRVARPPVMITDRLGVEVFYFGRPAMSLEVERKVFILCSQNPLADISHSCLHSRKGLRVLLPKPDDNNTGPGDVNLLAAVLRSFASGLVIVSLRSGIYVKNLCKSTVLYHGNNPPKKFGVICGLSSRAVLDVFNVAQYRIQGHEHIKKTTVFIGGDPTSAEQFDMVPLVIKLRLRSVTCDD 1006
5 -36.800IDP91733 P88946_HHV8 [Human herpesvirus 8 type M]  ali follow..  15  92........IKDWIVCQVNSGKFPGVEWEDEERTRFRIPVTPLADPCFEWRRDGELGVVYIRERGNMPVDASFKGTRGRRRMLAALRRTRGLQEGKGISQDGHHFLVFRVR---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KPEEEQCVECGVVAGAVHDFNNMARLLQEGFFSPGQCLPGEIVTPVPSCTTAEGQEAVIDWGRLFIRMYYNGEQVHELLTTSQSGCRISSALRRDPAVHYCAVGSPGQVWLPNVPN-LACEIAKRELCDTLDACAKGILLTSSCNGIFCVCYHNGPVHFIGNTVPPDSG--LLLPQGKPTRIFNPNTFLVGSHVTCPLVKLWLGKPVAVGKLEPHAPSPRDF......... 423
6 -16.700IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali follow..  1725......................................................................................................................................KAKPGLSMGAALLAVRARSRLQRKHLAQQLSSSSSSEVSASSASSLSPSSSSSSDFAETRAKADALRARLQAAQARLAAARETEVSSSETESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMVSGVKAAYRRLEEENTRLAATRRRDDKLQRQVEAERERAVELLKEATRRAKEE---KDLIARQPPPARDWSDTVVLSTPQIFVNSQAACAPFADSGRDEGGRDEWYEVSDACSRRAESSNESRTTAGAKLRQQQLDLA------GR.............................................................................................................................................................. 1989
7 -16.300IDP06534 Surface protein from Gram-positive cocci, anchor region [Enterococcus faecium DO] EAN10892 [Enterococcus faecium DO]  ali follow..  2...............................................................................................................................KKTATVLFVILGLSIIAAMIGISTSANERANENLSFTVKTDRIVYDMTQQVITIPVKPNKSVNASDVHAVLTYGWDGNGSSEKVIGEVYLKDVQWTAGIEYTIMISAELSIDEIKSKDKVDLIVFYDGQMTITENLKPSSWTVVGPPSSTDSTSSESSTENTSGESSTESTSSESSTENTSSESSTESTSSESSTGSTSSESSTESTSSESSTGSMSSESSTGSTSSESSTGKVNNELDLVPIIPTKEQKRNAGSNLKSVLKQP............................................................................................................................................................................... 265
8 -15.900IDP91949 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007099 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  768..........................................................................................................................................................KLNQGTTRTAGNKIPVTFMANAYLDNQSTYIVEVPILEKENQTDKPSILPQFKRNKAQENSKLDEKVEEPKTSEKVEKEKLSETGNSTSNSTLEEVPTVDPVQEKVAKFAESYGMKLENVLFNMDGTIELYLPSGEVIKKNMADFTGEAPQGNGENKPSENGKVSTGTVENQPTENKPADSLPEAPNEKPVKPENSTDNGMLNPEGNVGSDPMLDPALEEAPAVDPVQEKLEKFTASYGLGLDSVIFNM----DGTIELRLPSGEVIKKN.............................................................................................................................................. 1033
9 -15.700IDP06468 gene: A5L; A5L [Monkeypox virus Zaire-96-I-16] NP_536542 [Monkeypox virus Zaire-96-I-16]  ali follow..  8..........................................................................................................................................SQGLAESSTPKSSIYYSEEKDPDTKKDEAIEIGLKSQESYYQRQLREQLARDNMMVASRQPTQPLQPTIHITPQPVPTPTPAPILLPSSTAPVLKPRQQTNTSSDMSNLFDWLSADTDAPASTLLPALTPSNTVQDIISKFNKDQKMTTPPSTQPSQTLPTTTCTQQSDGSISCTTPTVTPLQPPIVATVCTPTPTGGTVCTTAQQNPNPGAASQQNLDDMTLKDLMSSVEKDMRQLQAETND......................................................................................................................................................................................... 250
10 -15.500IDP92738 gene: hsa; streptococcal hemagglutinin [Streptococcus gordonii] BAA97453 [Streptococcus gordonii]  ali follow..  86..........................................................................................................................SSVYAEEEQALEKVIDTRDVLATRGEAVLSEEAATTLSSEGANPVESLSDTLSASESASANSVSTSISISESFSVSASASLSSSSSLSQSSSESASASESLSVSASTSQSFSSTTSSTQSSNNESLISSDSSNSLNTNQSVSARNQNARVRTRRAVAANDTEAPQVKSGDYVVYRGESFEYYAEITDNSGQVNRVVIRNVEGGANSTYLSPNWVKYSTENLGRPGNATVQNPLRTRIFGEVPLNEIVNEKSYYTRYIVAWDPSGNATQM............................................................................................................................................................................... 354
11 -15.100IDP91577 gene: ECs4550; EspF protein [Escherichia coli O157:H7 str. Sakai] BAB37973 [Escherichia coli O157:H7 str. Sakai]  ali follow..  17..........................................................................................................................................VGIASRVSSAGGTGFSVAPQAVRLTPVKVHSPFSPGSSNVNARTIFNVSSQVTSFTPSRPAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPPPTSGQASGASRPLPPIAQALKEHLAAYEKSKGPEALGFKPARQAPPP---PTGPSGLPPLAQALKDHLAAYEQSKKG................................................................................................................................................................................................. 248
12 -15.000IDP92737 platelet-binding glycoprotein [Streptococcus sanguinis SK36] YP_001034807 [Streptococcus sanguinis SK36]  ali follow..  1.........................................................................................................................MFFKRQKGKYHEVERVTRFKLIKSGKHWLRAATSQFGLFRSMKGGGLSSIELKVTEEQVTDKKSGIDFLRGIVATGAVLGGAVVTSTTVHAEEGQALEKVIDTTDVLATRGETVLGEESSAAEAATATASSHTESESVSDTSSASASASVSASISASISASESMSQFSSASISASTSQAVSDSLSVSESLSVSSSTSDSVSASQPASTSASSKSESTVNSQSASSETNRSSTNNGSTSSSSETARVRKRRATDTTPPTITVPSDIIAYRG............................................................................................................................................................................... 270
13 -15.000IDP06012 membrane-attack complex / perforin domain-containing protein [Toxoplasma gondii ME49] EEB00555 [Toxoplasma gondii ME49]  ali follow..  4................................................................................................................................SAIGGIGPTESRLQHIPFSTTRYLPIRSHVLQSTVERIESPEALNEVPTKVERNEFTEKGDKTEQVLTAQADHKSLLEGRSVRLESTSTAPDDDFDFLFEDDTPKKPKSRVNKGTSSDETSPGDRSSGEGSSDSDSLLSVVHRTKGNATQANKNQTRITHPKSKAQHQKKVTKKQGIPGSDSLGTSSADFDFDIDSSSNTQADDSQRQSLGDSSALDLFGSDTGDTGDIFGFSNSSSDGGNAAANDGGLFSSSGMGPTGASDETS............................................................................................................................................................................. 268
14 -14.500IDP92613 RecName: Full=Serine-rich adhesin for platelets; AltName: Full=Staphylococcus aureus surface protein A; Flags: Precursor SAOUHSC_02990 [Staphylococcus aureus subsp. aureus NCTC 8325]  ali follow..  9...........................................................................................................................................HDSLANEKTRVRLYKSGKNWVKSGIKEIEMFKIMGLPFISHSLVSQDNQSISKKMTGYGLKTTAVIGGAFTVNMLHDQQAFAASDAPLTSELNTQSETVGNQNSTTIEASTSTADSTSVTKNSSSVQTSNSDTVSSEKSEKVTSTTNSTSNQQEKLTSTSESTSSKNTTSSSDTKSVASTSSTEQPINTSTNQSTASNNTSQSTTPSSVNLNKTSTTSTSTAPVKLRTFSRLAMSTFASAATTTAVTA................................................................................................................................................................................... 256
15 -14.200IDP04210 ZZZ_0017 [Escherichia coli O157:H7 str. EDL933]  ali follow..  1.......................................................................................................................................MINNVSSLFPTVNRNITAVYKKSSFSVSPQKITLNPVKISSPFSPSSSSISATTLFRAPNAHSASFHRQSTAESSLHQQLPNVRQRLIQHLAEHGIKPARSMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLVQHLAEHGIQPARNMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPPLPVQNEQSRPLPDVAQRLMQHLAEHGINTSKRS............................................................................................................................................................................................ 243
16 -14.000IDP06528 gene: scm; collagen-binding MSCRAMM Scm (Fms10) [Enterococcus faecium DO] AFK60297 [Enterococcus faecium DO]  ali follow..  357............................................................................................................................................SSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTSTTTSDSTDTSASSDSTDTTSTTSDSSDSSTTTSDSTDTSASSDSTDTSSTTSDSSDSSTSSDSTDTSSTTSDTRHASVSFSKTSSDNRTNFNLTNKTSNDNGNKSKRALPKTGSQSNNWITLAGVILLVIGLRITFMSYKKSKR................................................................................................................................................................................... 603
17 -13.800IDP90339 hypothetical protein CT050 [Chlamydia trachomatis D/UW-3/CX] CT050 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  242............................................................................................................................................QAPTPEPDPDPEPAPEPEPDTSDSSGSGSENPADPAPTNPSDSNAQNNPTPSSNGATASIRKLAATTTTVPTDTEIAPAAEDPNLPNTTFSEKSPLWEEFFSFSDSSRSEMVIQKTGILTFSMQGTWENPSSSQTPSTDPISLELTVTPPTTDTPPESPPSPPEAPAPEATPSPTNNNLTASITKTFSRKYNLSATPSPTPTTPTEPTTITKTLSLSSGQSCTLQIPVQATRSVLKLKYVNPNNNSSGGSSG.............................................................................................................................................................................. 493
18 -13.200IDP91664 gene: BBC3; bcl-2-binding component 3 isoform 4 [Homo sapiens] NP_055232 [Homo sapiens]  ali follow..  10  2.................................................................................................................................................................................ARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAV----SCGLCEPGLAAAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN................................................................................................................................................................................................. 193
19 -13.100IDP91504 putative translocation protein in type III secretion [Vibrio parahaemolyticus RIMD 2210633] VP1670 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  34..........................................................................................................................................ERALKENPDQTKPQPNETNNQAALEAKKPFTENYSERSLASLHSTGSNQRKTAEKSAFAQNNDVVTENINNESDTSSPIALNTQDKMPSDMDANMKPDIRIPTTGDKKLPMEPSNKREKNADEQDAFERLVEDHDDSKTELAAAKTAESHESTQSPKDTKHIPTAGTKPNTVETVSDALASTLASTTVASATSASLASHPVTSTVHKTATKTEVNKHEGDSSLGFNSRNLKTPIPNDEHPKASQA....................................................................................................................................................................................... 278
20 -12.900IDP91616 gene: ECs2715; EspF-like protein [Escherichia coli O157:H7 str. Sakai] BAB36138 [Escherichia coli O157:H7 str. Sakai]  ali follow..  10  1.......................................................................................................................................MINNVSSLFPTVNRNITAVYKKSSFSVSPQKITLNPVKISSPFSPSSSSISATTLFRAPNAHSASFHRQSTAESSLHQQLPNVRQRLIQHLAEHGIKPARSMAEHIPPAPNWPAPPPPVQNEQSRPLPDVAQRLVQHLAEHGIQPARNMAEHIPPAPNWPAPPLPVQNEQSRPLPDVAQRLVQHLAEHGIQPARSMAEHIPPAPNWPAPPPPQNEQSRPLPDVAQRLMQHLAEHGIQPARNMAEHIPPAPNWPAPTP.............................................................................................................................................................................. 258
21 -12.500IDP06506 gene: fms22; LPXTG family cell surface protein Fms22 [Enterococcus faecium DO] AFK59070 [Enterococcus faecium DO]  ali follow..  140............................................................................................................................................NDHHHLTPYSQRQTIEQDSAIDSGGDLVEEPTDKPENENKPEVPPTENPDGEQKPEIEPGEEPDTETQPEPDNESKPEITPGEKPDVDPEEKPDVTPEPDTDSGNQTVPETNPDTDNETENPEKPEVAPEEKPDVTPEPDTDSGNQTVPETNPDTDNETENPEKPEVDPEEKPDVTPEPDTDARDQGIPEKINKKTIQEDGKKESKKSNLAILKINEEQLNKKSRIFDSAQSAETLKSSKDTTFASPETKNKQLPK.......................................................................................................................................................................... 395
22 -12.500IDP92612 gene: gbs1529; Unknown [Streptococcus agalactiae NEM316] CAD47188 [Streptococcus agalactiae NEM316]  ali follow..  596..........................................................................................................................LVKIPKQSGVLYSTVSDINQTYGSKYSYGHTNISGDSDANAEIKLLSESASTSASTSASTSASMSASTSASTSASMSASTSASTSASMSASTSASTSASTSTSTSASTSASTSASTSASMSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASTSASMSASMSASTSASMSASTSASTSASTSASTSASTSASTSASMSASTSASTSASTSASMSASTSASTSASTSASTSASTSTSTSASTS............................................................................................................................................................................... 864
23 -12.200IDP91682 gene: ORF73; nuclear antigen LANA [Murid herpesvirus 4] MuHV4gp74 [Murid herpesvirus 4]  ali follow..  10  14..........................................................................................................................................GKTRSGCKRRCFNKPAAMPPKRRRAPKRPAPPPPPGCQGDEESSQGTQTPNPPSPPVPPSSPTLPSSPVPPSSPVHEPPSPSPPPAPPSPDVDVEGLDVGETDDPGPPPPKRYSRYQKPHNPSDPLPKKYQGMRRHLQVTAPRLFDPEGHPPTHFKSAVMFSSTHPYTLNKLHKCIQSKHVLSTPVSCLPLVPGTTQQCVTYYLLSFVEDKKQAKK-LKRVVLAYCEKYHSSVEGTIVKAKPYFPLPEPPTEPPTDPEQP........................................................................................................................................................................ 272
24 -12.100IDP05117 putative collagen-binding protein [Clostridium difficile 630] CD2831 [Peptoclostridium difficile 630]  ali follow..  3...................................................................................................KGNRKAL--LISLIMI-----------------LSMVVSTIYPTVSYASELGENSQIQSGSTNSSTGEEKESDNKKPEQTPEKDKATDNKKPEQTPEEEKPTDNKKPEQTPEEDKSTDNKKPEQTPEGEKPIDNKKPEQIPEEDKSTDNKKSEQALEDEKPLDNKNTEKTPEEDNLLEDENLLKVLEEELNEENEDYGFVVKINNNTIETESMKK............................................................................................................................................................................................................................................................ 198
25 -12.100IDP06379 gene: ORF45; ORF45 [Human herpesvirus 8] YP_001129397 [Human herpesvirus 8]  ali follow..  138..........................................................................................................................................HTPKPVAVVAGRVRSSTDTAESEASMGWVSQDDGFSPAGLSPSDDEGVAILEPMAAYTGTGAYGLSPASRNSVPGTQSSPYSDPDEGPSWRPLRAAPTAIVDLTSDSDSDDSSNSPDVNNEAAFTDARHFSHQPPSSEEDGEDQGEVLSQRIGLMDVGQKRKRQSTASSGSEDVVRCQRQPNLSRKAVASVIIISSGSDTDEEPSSAVSVSPSSTKGHLPTQSPSTSAHSISSGSTTTAGSRCSDPTRILASTP.............................................................................................................................................................................. 393
26 -11.500IDP05070 putative surface protein [Clostridium difficile 630] CD3246 [Peptoclostridium difficile 630]  ali follow..  4..............................................................................................................................................TAFTPIVSYADEVTSNDTILNGEEQSNGQTPDVEKPSDGQVPGGEKPSDSQVPDGEKPSDGQVPDGEKPSDGQIPDGESDGQIPDGEKPSDGQIPDGEKPSDGQMPDGEKTSDSQTPDVEKPSDGQMPDGEKPLDEQTPEEEKPLEEEIVIEEMSLKQDIDKILDMTLSQINKIVYNFWEDEEDVKADEQSEINQVFTSEDSFISLWYDKKAKVKNSCLLKEIDGSDRPYHDLRFDDITKTLTFD................................................................................................................................................................................... 250
27 -11.400IDP92687 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus str. Newman] YP_001331559 [Staphylococcus aureus subsp. aureus str. Newman]  ali follow..  2..........................................................................INRDNKKAITKKGMISNRLNKFS------IRKYTVTASILVGTTLIFGLGNQEAKAAENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDGKDNVAAAHD....................................................................................................................................................................................... 305
28 -11.400IDP91910 surface protein PspC, partial [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100003565 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  1...................................................................................................................................................................................................KPKPEVKPQLEKPKPEDKPQLEKPKPEVKPQLEKPKPEVKPQLEKPKPEDKPQLEKPKPEVKPQLEKPKPEVKPQLEKPKPEDKPQLEKPKPEVKPQLEKPKPEVKPQPEKPKPDNSKPQADDKKPSTTNNLSKDKQPSNQASTNEKATNKPKKSLPSTGSISNLALEIAGLLTLAGATILAKKRMK........................................................................................................................................................................................ 187
29 -11.300IDP92610 gene: srr-2; serine-rich repeat protein [Streptococcus agalactiae] AAZ95526 [Streptococcus agalactiae]  ali follow..  866..........................................................................................................................................SSESVSNSESISSSESVSSSESVSSSESISTSESVSNSESISSSESVSNSESISSSESVSNSESISSSESVSNSESISSSESVSSSESISSSESVSSSESVSNSESISSSESVSNSESISSSESVSSSESISSSESVSNSESILSSESVSSSESISSSESISSSESVSMSTTESLSESEVSGDSEISSSTESSSQSESMNHTEIKSDSESQHEVKHQVLPETGDNSASALGLLGAGLLLGATKSRKKKK................................................................................................................................................................................... 1114
30 -11.200IDP00768 superantigen-like protein SACOL0470 [Staphylococcus aureus subsp. aureus COL]  ali follow..  1.........................................................................................................................................MKMRTIAKTSLALGLLTTGAITVTTQSVKAEKIQSTKVDKVPTLKAERLAMINITAGANSATTQAANTRQERTPKLEKAPNTNEEKTSASKIEKISQPKQEEQKTLNISATPAPKQEQSQTTTESTTPKTKVTTPPSTNTPQPMQSTKSDTPQSPTIKQAQTDMTPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVR........................................................................................................................................................................................................................................ 197
31 -11.100IDP06537 Surface protein from Gram-positive cocci, anchor region [Enterococcus faecium DO] EAN08832 [Enterococcus faecium DO]  ali follow..  414............................................................................................................................................SSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTTSTTSDSTDTSASSDSTDTSTTTSDSTDTSASSDSTDTTSTTSDSSDSSTTTSDSTDTSASSDSTDTSSTTSDSSDSSTSSDSTDTSSTTSDTRHASVSFSKTSSDNRTNFNLTNKTSNDNGNKSKRALPKTGSQSNNWITLAGVILLVIGLRITFMSYKKSKR................................................................................................................................................................................... 660
32 -11.000IDP90350 hypothetical protein CT456 [Chlamydia trachomatis D/UW-3/CX] CT456 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  67..........................................................................................................................................YTNSASAPNVTVSTSSSSTQATATSNKTSQAVAGKITSPDTSESSETSSTSSSDHIPSDYDDVGSNSGDISNNYDDVGSNNGDISSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSGGAAAALNSLRGSSYSNYDDAAADYEPIRTTENIYESIGGSRTSGPENTSDGAAAAALNSLRGSSYTTGPRNEGVFGPGPEGLPDMS........................................................................................................................................................................... 323
33 -11.000IDP92699 Ser-Asp rich fibrinogen/bone sialoprotein-binding protein SdrE [Staphylococcus aureus subsp. aureus USA300_TCH1516] YP_001574462 [Staphylococcus aureus subsp. aureus USA300_TCH1516]  ali follow..  2..........................................................................INRDNKKAITKKGMISNRLNKFS------IRKYTVTASILVGTTLIFGLGNQEAKAA---------ENTSTENAKQDDATTSDNKEVVSETENNSTTENNSTNPIKKETNTDSQPEAKKESTSSSTQKQQNNVTATTETKPQNIEKENVKPSTDKTATEDTSVILEEKKAPNNTNNDVTTKPSTSEPSTSEIQTKPTTPQESTNIENSQPQPTPSKVDNQVTDATNPKEPVNVSKEELKNNPEKLKELVRNDSNTDHSTKPVATAPTSVAPKRVNAKMRFAVAQPAAVASNNVNDLIKVTKQTIKVGDGKDNVA.................................................................................................................................................................................. 301
34 -11.000IDP05386 hypothetical protein BA_2029 [Bacillus anthracis str. Ames] BA_2029 [Bacillus anthracis str. Ames]  ali follow..  13...................................................................................................................................................................................................SVLGFGIFGFTHGNGGGVVQAASEGDGGGAPAGNHGGAPTYTHGEGWSPSYAHGHTGGAPSYTHGHTGAPVYGYGDYPIPSFNVGDTPAPRLDADGDHGGAPTYTHGHFPAPKLESDGYTGGAPSYNKEDTWSPSYAHGNTGAPSNTEPGGG........................................................................................................................................................................................................................... 167
35 -10.900IDP90291 high mobility group (HMG) box domain-containing protein [Toxoplasma gondii ME49] TGME49_081900 [Toxoplasma gondii ME49]  ali follow..  14...............................................................................................................................MRVTVSCALLPEVLKQGAEAGGAVKLTGNPSEQSSEDGSHHCSSNFQNSPVTSDLSVLDASPCGLPAEKRKPPHRETSISSNASQSEREIAPTATRRLSPKPETATLSPSESSSLTAATLSNCSSRVQSSSDEKIGNCPSTSACSVSQTTASSEAPSWLSSGASTAQVLSERRGSIEEQPAPETSAAAVRVSRSSSDSENLFASCSASLRNLEPDDISDPENEAAAPACAETGASRAQDAAAVRADAENLGEGESHMETASTRAESLAKDAISSKV................................................................................................................................................................... 289
36 -10.200IDP91522 conserved hypothetical protein [Toxoplasma gondii GT1] TGGT1_033230 [Toxoplasma gondii GT1]  ali follow..  2.............................................................................................................................................EARTSGKALPPGVDATTISSPAQGRCNVVPGAGQRTHLASQATSAFVQAAISVDQQRGSKQMVAQCLTQSTHVREMASHLGGRPTHFNQVVDQQYTSTCTTTGCTSGTYLHPPSSTALRGLTDSTEKPLPGTPQLYSPSHPGKAVQQLERLMRPCATAHSLPVPPTGAPVTVSGSALPSTTVPAGGVPGTQQGEEGVPSEVADSFFPGSDLQSRAMLKAKPGVPAETVARPSADIASGPVQSPAPAPALPTPPENTLIILD-----IQTINICLARGMVVIVTNATVEWVNRSG-------EKFIP-------------QVLRHIQ--TQGIEIISARD...................................................................................... 351
37 -10.000IDP91728 gene: BIN1; myc box-dependent-interacting protein 1 isoform 1 [Homo sapiens] NP_647593 [Homo sapiens]  ali follow..  255................................................................................................................................EMSKLNQNLNDVLVGLEKQHGSNTFTVKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQD---------------------------------EGWLMGVK-LEKCRGVFPENFTE............................................................................. 590
38 -9.910IDP05007 putative lipoprotein [Bacillus anthracis str. Ames] BA_3383 [Bacillus anthracis str. Ames]  ali follow..  1.........................................................................................................................................MKMKKVAIASITIGTMLTMAACSPSADKETDKKEQVTAQNEGEVKTTSTDETSKTTKDTDKETNTSSNEKTDKDAKNTKESSGTESNGKTSTQNENVKTKEKETTGKTNDQTTSGKTTDQSTSTNSDGKTTKDPKKSVAVKTSVKEVAALVDSLDKQLAANPKLETVNKLGKQINAKWDVIEKELETSHPAEYKTIGQSMYPLIVGAEKEKIDITK..................................................................................................................................................................................................................... 216
39 -9.840IDP91749 Q9DUM3_HHV8 [Human herpesvirus 8]  ali follow..  2..............................................................................................................................................APPGMRLRSGRSTGAPLTRGSCRKRNRSPERCDLGDDLHLQPRRKHVADSVDGRECGPHTLPIPGSPTVFTSGLPAFVSSPTLPVASIPSPAPATPLPPPALLPPVTTSSSPIPPSHPVSPGTTDTHSPSPALPPTQSPESSQRPPLSSPTGRPDSSTPMRPPPSQQTTPPHSPTTPPPEPPSKSSPDSLAPSTLRSLRKRRLSSPQGPSTLNPICQSPPVSPPRCDFANRSVYPPWATES....................................................................................................................................................................................... 242
40 -9.640IDP05393 hypothetical protein BA_3225 [Bacillus anthracis str. Ames] BA_3225 [Bacillus anthracis str. Ames]  ali follow..  11  9......................................................................................................................................................................................SKGNEEHYNHQISMSSLYVQPKITKADEMSGLKISENWSCRFYPVGWDSPVNYTGFNPQTLPFSSGHPTHYAGMIPQGQPANWTPFPGHTGFNFQKPPFPWAQPFNHTGMFAQGHLAALLSPPAKAFKFNINN----GGIFGNSPGWGGQISPMGWGNNGGYGQPGMLGNLLTVGKGTMNG........................................................................................................................................................................................................... 185
41 -9.630IDP91727 gene: BCL2L11; bcl-2-like protein 11 isoform 1 [Homo sapiens] NP_619527 [Homo sapiens]  ali follow..  2.....................................................................................................................................................................................................................AKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPE................................................................................................................................................................................................................. 145
42 -9.590IDP05372 LPXTG-motif cell wall anchor domain protein [Bacillus anthracis str. Ames] BA_0397 [Bacillus anthracis str. Ames]  ali follow..  2...................................................................................................................................................TKIFILASTLSLSFFSGLNIGNAATENFSPITNAIVQNNDYFVEGNSKDNNKPPGNGGSQDDSGSDGNGSDGSGSGDNGSGDNGSGGNGSGGNGSGENGSGGNGSGSSGSGDNGSGGNGSGGNGSGSSGSGENGSGGNGSGSSGSGENGSGGNGSGSSGSGENGSGGNGSGGNGSGGNSSGGSGSGGSGSQGGNRVKGDSSSQGGNGSQGGNVKDNAKKQGDKLPNTATHYPASIL....................................................................................................................................................................................... 237
43 -9.460IDP02382 hypothetical protein lmo0320 [Listeria monocytogenes EGD-e] lmo0320 [Listeria monocytogenes EGD-e]  ali follow..  10  183..................................................................................................................................ESFQEQLNNAQQQLDARIAQEQAAIQAVNQLFLEDSPVNSIKAETTQDLIDQAQTLVDVLPASELKDTLQANIVKAQTELDERSKPVTPPKNDPEPDNPEEPVTPVDPATPIPDEPSTPTDPATPEKPEITTPENPESTVVEADSSENEPEKSADSKIVNNPIQITSQATKTATKQAKSSATKTTLPLPKAGDTET................................................................................................................................................................................................................................................ 378
44 -9.390IDP05521 putative cell surface protein [Clostridium difficile 630] CD1858 [Peptoclostridium difficile 630]  ali follow..  103..........................................................................................................................FLFYEVKGDGKDEIIRKVTKIDVKDKETQTENESSKSEQSSQSNASKIENKGTQTELSKDDISKMEKESKELKEKLDKLNQEIKDKDKLSEKQKDKIKDLEEKIDKLKEKLEKGKDDKDLSADMKKEIDKLTDKIKELEKKANEVGRAPVMHNPTVTPISPISGIKQGTGNVSPQTSINSSGKGSATQESKGANTKDTNSNESKEKEKQVCYPNKLTPKQPANNGSHDSSLDGSSKNINTNKGVASEPSKARGTVTENKDN....................................................................................................................................................................................... 363
45 -9.270IDP05315 cell wall anchor domain-containing protein [Bacillus anthracis str. Sterne] BAS0383 [Bacillus anthracis str. Sterne]  ali follow..  1........................................................................................................................................MTKIFILASTLSLSFFSGLNIGNAATENFSPITNAIVQNNDYFVEGNSKDNNKPPGNGGSQDDSGSDGNGSDGSGSGDNGSGDNGSGGNGSGGNGSGENGSGGNGSGSSGSGDNGSGGNGSGGNGSGSSGSGENGSGGNGSGSSGSGENGSGGNGSGSSGSGENGSGGNGSGGNGSGGNSSGGSGSGGSGSGDNGSGGSGSQGGNRVKGDSSSQGGNGSQGGNVKDNAKKQGDKLPNTATHYPASIL....................................................................................................................................................................................... 247
46 -9.200IDP00754 gene: spa; immunoglobulin G binding protein A precursor SACOL0095 [Staphylococcus aureus subsp. aureus COL]  ali follow..  248..........................................................................................................................................DPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDGNKPGKEDGNGVHVVKPGD------TVNDIAKANGTTADKIAADNKLADKNMIKPGQELVVDKKQPANHADANKAQALPETGEENP........................................................................................................................................................................................... 482
47 -9.180IDP91181 wall surface anchor family protein [Chlamydophila felis Fe/C-56] CT578 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  4...........................................................................................................................................................SSSSSSDSSNLKNVLSQVIASTPQGVPNADKLTDNQVKQVQQTRQNRDDLSMESDVAVAGTAGKDRAASASQIEGQELIEQQGLAAGKETASADATSLTQSASKGASSQQCIEDTSKSLELSSLSSLSSVDATHLQEIQSIVSSAMGATNELSLTNLETPGLPKPSTTPRQEVMEISLALAKAITALGESTQAALENFQSTQSQSANMNKMSLESQGLKIDKEREEFKKMQEIQQK............................................................................................................................................................................... 239
48 -9.170IDP05543 hypothetical protein CD2628 [Clostridium difficile 630] CD2628 [Peptoclostridium difficile 630]  ali follow..  403...........................................................................................................................................RVKVVGGLKEGYSNIVFKPGFIMGGGDNQETPDDERENDDIDGDRGGGGRDDPDRDEDDNNQDGNNGNENNDSNNNQNNNNENNNNENDDSDEKQPNTPKDDVESSTDSNENKNPHDIPKDGNKENNSDKEKGFYNKNSITENDDNYDLSSKSVFGTNEHSFPYRESISNKNQDTNKNKSNISDYDGIINNNYKLESKEYNLKKDIIFLFCILTPIMIGSILIVNPDTRK..................................................................................................................................................................................................... 632
49 -9.120IDP01843 gene: actA; actin-assembly inducing protein precursor [Listeria monocytogenes EGD-e] lmo0204 [Listeria monocytogenes EGD-e]  ali follow..  33..........................................................................................................................................SEDSSLNTDEWEEEKTEEQPSEVNTGPRYETAREVSSRDIKELEKSNKVRNTNKADLIAMLKEKAEKGPNINNNNSEQTENAAINEEASGADRPAIQVERRHPGLPSDSAAEIKKRRKAIASSDSELESLTYPDKPTKVNKKKVAKESVADASESDLDSSMQSADESSPQPLKANQQPFFPKVFKKIKDAGKWVRDKIDENPEVKKAIVDKSAGLIDQLLTKKKSEEVNASDFPPPPTDEELRLALPETPMLLG.............................................................................................................................................................................. 286
50 -9.010IDP00769 superantigen-like protein SACOL0472 [Staphylococcus aureus subsp. aureus COL]  ali follow..  4......................................................................................................................................................................TTIAKTSLALGLLTTGVITTTTQAANATTPSSTKVEAPQSTPPSTKIEAPQSKPNATTPPSTKVEAPQQTANATTPPSTKVTTPPSTNTPQPMQSTKSDTPQSPTTKQVPTEINPKFKDLRAYYTKPSLEFKNEIGIILKKWTTIRFMNVVPDYFIYKIALVGKDDKKYGEGV................................................................................................................................................................................................................................... 176

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.