current user: public

If you have questions about the server, please let us know.

Query: IDP91766 gene: yhhY; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3441 [Escherichia coli str. K-12 substr. MG1655], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MSEIVIRHAETRDYEAIRQIHAQPEVYCNTLQVPHPSDHMWQERLADRPGIKQLVACIDGDVVGHLTIDVQQRPRRSHVADFGICVDSRWKNRGVASALMREMIEMCDNWLRVDRIELTVFVDNAPAIKVYKKYGFEIEGTGKKYALRNGEYVDAYYMARVKLast
1 -83.000IDP91766 gene: yhhY; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3441 [Escherichia coli str. K-12 substr. MG1655]  ali  100  1MSEIVIRHAETRDYEAIRQIHAQPEVYCNTLQVPHPSDHMWQERLADRPGIKQLVACIDGDVVGHLTIDVQQRPRRSHVADFGICVDSRWKNRGVASALMREMIEMCDNWLRVDRIELTVFVDNAPAIKVYKKYGFEIEGTGKKYALRNGEYVDAYYMARVK 162
2 -61.800IDP91767 gene: speG; spermidine N1-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1584 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  19  5.HSVKLRPLEREDLRYVHQLDNNASVMRYWFEEAFVELSDLYDKHIHDQSERRFVVECDGEKAGLVELV--EINHVHRRAEFQIIISPEYQGKGLATRAAKLAMDYGFTVLNLYKLYLIVDKENEKAIHIYRKLGFSVEGELMHEFFINGQYRNAIRMCIFQ 166
3 -61.600IDP95485 spermidine acetyltransferase [Staphylococcus aureus] ADV68932 [Staphylococcus aureus]  ali follow..  18  1...MKLRALEYSDLLFVHELNNEYSIMSYWFEESLTELQYLFDKHLLDESERRFIVEDENQVVGIVELV--EINYIHRNCEIQIIIKPEFSGKGYAKFAFEKAINYAFDILNMHKIYLYVDTDNKKAVHIYESQGFKTEGLLKEQFYTKGKYKDAYFMSLLK 160
4 -61.300IDP95484 gene: speG; spermidine acetyltransferase [Yersinia pestis Z176003] ADE65402 [Yersinia pestis Z176003]  ali follow..  21  5.SSVRLRPLEREDLPFVHQLDNNASIMRYWFEEAFVELCDLYDKHIHDQSERRFIIESQGTKIGLVELV--EINHIHRRAEFQIIIDPTHQGKGYAGAAAKLAMEYGFSVLNLYKLYLIVDKENEKAIHIYSKLGFEIEGELKQEFFINGEYRTVIRMCIFQ 166
5 -59.200IDP01616 spermidine n1-acetyltransferase [Vibrio cholerae O1 biovar eltor str. N16961] VC_A0947 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  3.SQLTLRALERGDLRFIHNLNNNRNIMSYWFEESFDELEELYNKHIHDNAERRFVVEAQKNLIGLVELI--EINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQ 165
6 -57.300IDP05730 putative acetyltransferase [Clostridium difficile 630] CD0675 [Peptoclostridium difficile 630]  ali follow..  18  2IEGIKFIKAEEKYIYSYWQTFDKIAKERKYLAMDEATVEFIKNIINKNLPQLFIIDLESDNCIGWCDV----LPKTEKVGYLGMGILKEYREKGIGSSLLKQIIDLSKEY-GYEKIELDVFKSNSRAIHVYKSLGFVEVNTISSGFTWNDRPVKEEVIQM.. 161
7 -54.800IDP01688 GNAT family acetyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1313 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  16  2IKLKNFAELNSQEIKLIFKWRNHPDISQFMKTIDFEEHLRFIRNLHQDSNKKYFLVFQDEQIIGVIDFVNIT----TKSCEFGLYAIPD--LKGVGQVLMNEIKKYAFEILKVDTLKAYVFKDNHKALKLYQQNHFTIYDEDKDFYYVCLKQSHCKALP... 156
8 -54.700IDP95446 set236a-048 [Undefined organism]  ali follow..  15  5.KRVSFRPMSEDDLVLMLKWLTDDRVLEFYDGRDKKHTQKTIREHYTADEIYRVIIEYDTIPIGYAQIYRIQHETEEKIYAMDQFIGPEYWNMGIGAEYCRVVCQYLRTEMDANAVILDPRKNNPRAVRAYQKAGFEIIKELPEHELHEGKKEDCVLMEWR. 177
9 -54.500IDP95450 set236a-052 [Undefined organism]  ali follow..  15  5.KRVSFRPMSEDDLVLMLKWLTDDRVLEFYDGRDKKHTQKTIREHYTADEIYRVIIEYDTIPIGYAQIYRIQHETEEKIYAMDQFIGPEYWNMGIGAEYCRVVCQYLRTEMDANAVILDPRKNNPRAVRAYQKAGFEIIKELPEHELHEGKKEDCVLMEWR. 177
10 -48.500IDP01725 acetyltransferase [Bacillus anthracis str. `Ames Ancestor`] GBAA2534 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  20  6.ERLLIRKFEFKDWEAVHEYTSDSDVMKYI-VFTEEDTRNFVNKNMGENANFPVILIGENILVGHIVFHKYF---GEHTYEIGWVFNPKYFNKGYASEAAQATLKYGFKEMKLHRIIATCQPENTPSYRVMEKIGMRREGYFKKCIPHGNEWWDEYYYAILE 166
11 -48.300IDP91269 acetyltransferase, GNAT family [Bacillus anthracis str. Sterne] NT05BA2958 [Bacillus anthracis str. Sterne]  ali follow..  18  9.ERLQLRELTLLDAETMFHYFSKESVIRYFGMDSFENIEQAKTTIQTFKNRYEIEKKGTGQLIGTCGFH--LINHHHKRAEIGYELDDTYWGQGYASEALQAILTYGFETLQLIRIAAVVYVENKASQKLLSKAGFQEEGLLRKHMIQNGVAHDTILYSLLK 175
12 -47.200IDP92632 gene: rimJ; ribosomal-protein-S5-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1066 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  16  16.DRLVVRLVHDRDAWRLADYYAENRHFLKPWECYPSGWQARLGMINEFHKQFGLFDPDEKEIIGVANFSNVVRGSF-HACYLGYSIGQKWQGKGLMFEALTAAIRYMQRTQHIHRIMANYMPHNKRSGDLLARLGFEKEGYAKDYLLIDGQWRDHVLTALTT 187
13 -46.800IDP92628 gene: rimL; ribosomal-protein-L7/L12-serine acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b1427 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  15  9.ESLELHAVAENHVKPLYQLICKNKTWLQQSVQSEEDTRKTVQGNVMRGYAKMFMIFKEDELIGVISFN--RIEPLNKTAEIGYWLDESHQGQGIISQALQALIHHYAQSGELRRFVIKCRVDNPQSNQVALRNGFILEGCLKQAEFLNDAYDDVNLYARII 176
14 -44.400IDP95442 set236a-044 [Undefined organism]  ali follow..  13  1...VEYKLLEKEDLELMKEIIED---------DDIEFDLEKINEFYNDKNVIGFIAKAENKIVGFAYGYDIIHPNGKHAYFISIGMLPDYQDKGYGTKLLGFIKDYISSN-GFFEMFVLTDKGNPRACHVYEKLGGKNDFEDEICYVYDFEGDEK....... 143
15 -44.100IDP91769 gene: yjcK; ribosomal-protein-alanine acetyltransferase [Yersinia pseudotuberculosis IP 32953] YPTB1890 [Yersinia pseudotuberculosis IP 32953]  ali follow..  11  14.KKIHLLVPDLSRSQEMHQLIVNFSNLNSSEETVFSNMSIASKNFSEDRDEYKFLINHTNQLVGCISLF--IRHAQIPYFEIGYWLSTQAMGYGFITEACILVRDLAYHHLKSKRLEIRMARRNIRSSKLAERCGFYCEAILKNNIDGFGCLDDTCIYIYSK 185
16 -44.100IDP95293 gene: aac(6`)-Ib; aminoglycoside 6`-N-acetyltransferase type Ib [Klebsiella pneumoniae] AAL93141 [Klebsiella pneumoniae]  ali follow..  16  23.DSVTLRLMTEHDLAMLYEWLNRSHIVEEARPTLADVQEQYLPSVLAQESVTPYIAMLNGEPIGYAQSYVALGSGDPGVRGIDQLLANSQLGKGLGTKLVRALVELLFNDPEVTKIQTDPSPSNLRAIRCYEKAGFERQGTV------TTPDGPAVYMVQTR 191
17 -41.700IDP01351 toxin resistance protein VCA0387 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  1...MEIXTGEFEDIAGITDIFNQTNARFEEFPFTLENREEWFSQFSRTAKYQIYVAVENGVLQGFACSQKRAIPAFDDTVEVSVYLAQEAKGKGLGSKLYTQLFSSIRAY-GVHRILSGVALPNDASVALHKRFGFREVGISNEYAKKHGQYISSLWLEKA. 162
18 -41.200IDP95410 set236a-012 [Undefined organism]  ali follow..  20  2...LIYRRLTEADAEAMRQMNQMFGAKDTKTYRYDQGDDAYFQRILGKDHVIVLACFHAGQVVGGLVAYVLDKLEMARSEIYDLAVDESHRRQGIATELINELKAIAAKT-GAWVIFVQADREDEPAIQLYEKLGVREEPLHFDINLEEGN........... 152
19 -40.600IDP92718 gene: aacC1; aminoglycoside-(3)-N-acetyltransferase [Serratia marcescens] AAB20441 [Serratia marcescens]  ali follow..  17  24MGIIRTCRLGPDQVKSMRAALDLFGREDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRSEIYDLAVSGEHRRQGIATALINLLKHEANAL-GAYVIYVQADYGDDPAVALYTKLGIREEVMHFD.................. 170
20 -39.700IDP92645 gene: ypeA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b2434 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  22  1...MEIRVFRQEDFEEVITLWERCDLLR-----PWNDPEMDIERKMNHDVSLFLVAEVNGDVVGTVMGGYDG----HRGSAYYLGVHPEFRGRGIANALLNRLEKKLIAR-GCPKIQINVPEDNDMVLGMYERLGYEHADVLGKRLIEDEEY.......... 141
21 -39.500IDP95033 ; aminoglycoside acetyltransferase [Pseudomonas aeruginosa] CAD53575 [Pseudomonas aeruginosa]  ali follow..  15  4.TQTKITRLNSQDVGVMRAMLGMFGFEDAENYCRAQPSDSYLQDLLCGSGFIAIAALQGQEVIGGLAAYVLPKFEQQRKEIYDLGVQGAYRRRGIATALINELQRIAHDI-GAYVIFVQADYGDDPAVALYTKLGIREDVMHFDI................. 150
22 -39.300IDP00047 streptothricin acetyltransferase, putative BA_3185 [Bacillus anthracis str. Ames]  ali follow..  18  2..SLLIRELETNDLDNFPEIDDSFIVNARLMLLQNDNEELVYNEYINKPNQIIYIALLHNQIIGFIVLKKN----WNNYAYIDITVDKKYRTLGVGKRLIAQAKQWAKEG-NMPGIMLETQNNNVAACKFYEKCGFVIGGFDFLVYKGLNMTSDEVAI.... 176
23 -39.300IDP02174 putative acetyltransferase [Yersinia pestis CO92] YPO3031 [Yersinia pestis CO92]  ali follow..  21  1...MEIRIFQQDDFEEVILLWEHCDLLR-----PWNDPEMDIERKLNHDPELFLVAEVNGTIVGSVMGGYDG----HRGSAYYLGVHPDYRGRGFANALISRLEKKLIAR-GCPKLNIMVREDNDAVIGMYEKLDYETQDTLGKRLIVDQEY.......... 141
24 -39.300IDP92640 gene: phnO; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b4093 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  18  1MPACELRPATQYDTDAVYALICELKQAE----FDHHAFRVGFNANLRDPNMRYHLALLDGEVVGMIGLHQFHLHHVNWIGEIELVVMPQARGLNVGSKLLAWAEEEARQA-GAEMTELSTNVKRHDAHRFYLREGYEQSHF..................... 138
25 -39.200IDP00087 gene: STM2449; putative acetyltransferase NTL01ST2379 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  21  36.NTMEIRVFRQEDFEEVITLWERCDLLR-----PWNDPEMDIERKVNHDVSLFLVAEVSGEVVGTVMGGYDG----HRGSAYYLGVHPEFRGRGIANALLNRLEKKLIAR-GCPKIQIMVRDDNDVVLGMYERLGYEHSDALGKRLIEDEEY.......... 178
26 -38.900IDP92031 N-terminal acetyltransferase complex subunit ARD1, putative [Toxoplasma gondii ME49] TGME49_019760 [Toxoplasma gondii ME49]  ali follow..  20  2...ATLRRADVFDLFAMQNANFINLPEN--------IMKYYFFHAVSWPQLLSVSHDSQGKLVGYVLAKLEEDDPTDHHGHVSVAVLRQSRKLGLASKLMNMTQHAMEEVFDADYASLHVRVTNRAAYSLYKHLGYRIHDIDKEY-YADKE--DAFSMRN.. 150
27 -38.600IDP92629 gene: yncA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b1448 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  17  1...MSIRFARKADCAAIAEIYNYTAAIWNDQTVDADNRIAWFEARTLA-GYPVLVSEENGVVTGYASFGDRSFDGFRHTVEHSVYVHPDHQGKGLGRKLLSRLIDEA-RDCGKHVMVAGIESQNQASLHLHQSLGFVVTAQMPQVGTKFGRWLDLTFMQL.. 160
28 -38.500IDP95405 set236a-007 [Undefined organism]  ali follow..  18  2..TYRIQQVTPADLDLMNELLSVFGQDDEETYNGKRPGAGYMRRLLESDNFIALAALNDQKVVGGLAAYELKKFERERSEIYDLAVAKNHRRKGIATALIMELKKIAAARAYVIFVQADTGAEDEPAIELYTKLGIREDVLHFDIPVENGD........... 155
29 -38.400IDP95418 set236a-020 [Undefined organism]  ali follow..  15  9.NFLKIERLAENDLPKFIQLIRLFEAVFEMKNFSIPDSEH-LQKLLNQNNFYVFVALLENKIVGGLTSYVLEQYYSEKPLAYDLAVDTNWQRQGIGKKLITATNQFYTEK-GFEEVFVQADKVDDYALDFYRSTKPTAE....................... 146
30 -38.400IDP00086 gene: yncA; putative acyltransferase NT01ST1973 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  18  1...MTIRFADKADCAAITEIYNHTAAIWNDRTVDTDNRLAWYEARQLL-GYPVLVSEENGVVTGYASFGDRSFDGFRYTVEHSVYVHPAHQGKGLGRKLLSRLIDEARRC-GKHVMVAGIESQNAASIRLHHSLGFTVTAQMPQVGVKFGRWLDLTFMQL.. 160
31 -38.100IDP95031 ; aminoglycoside 3`-N-acetyltransferase [Pseudomonas aeruginosa] AAA88422 [Pseudomonas aeruginosa]  ali follow..  17  23MSIIATVKIGPDEISAMRAVLDLFGKEDIPTYSDRQPTNEYLANLLHSETFIALAAFDRGTAIGGLAAYVLPKFEQARSEIYDLAVASSHRRLGVATALISHLKRVAVEL-GAYVIYVQADYGDDPAVALYTKLGVRED....................... 164
32 -37.900IDP95439 set236a-041 [Undefined organism]  ali follow..  12  3.GDFVVREATQADALALAELAIKLWSSH-----TISELQSEFLDLICSDNAVCFIKYVGSKAVGFAQCQLRNDYVEGTDTS-GIFVEEEYRHNGYAKELLSKCEKWAKEK-HCTEFASDCEINNEISLQFHLSMGFEEANR..................... 141
33 -37.800IDP91868 gene: aac(6`)-Ig; aminoglycoside 6`-N-acetyltransferase [Acinetobacter haemolyticus] AAA21889 [Acinetobacter haemolyticus]  ali follow..  15  1...MNIKPASEASLKDWLELRNK------LWSDSEASHLQEMHQLLAEKYALQLLAYSDHQAIAMLEASIRFEYVNGTETS-GIYVLPAHRRSGVATMLIRQAEVWAKQF-SCTEFASDAALDNVISHAMHRSLGFQETEK..................... 136
34 -37.600IDP91869 gene: aac(6`)-Ih; aac(6`)-Ih [Acinetobacter baumannii] AAC41391 [Acinetobacter baumannii]  ali follow..  1...MNIMPISESQLSDWLALRCLLWPDH-----EDVHLQEMRQLITQAHRLQLLAYTDTQQAIAMLEASIRYEYVNGTQTS-GIFVLPEYRRSGIATGLVQQVEIWAKQF-ACTEFASDAALDNQISHAMHQALGFHETER..................... 137
35 -37.500IDP95032 ; aminoglycoside acetyltransferase [Salmonella enterica subsp. enterica serovar Newport] AAR21614 [Salmonella enterica subsp. enterica serovar Newport]  ali follow..  17  2..SVEIIHLTGNDVALLQSINAMFGENDQDSYARNKPSSSYLQKLLSTSSFIALAAVDEQKVIGAIAAYELQKFEQQRSEIYDLAVAATRRREGIATALIKKLKAIGAAR-GAYVIYVDKGVEDQPAIELYKKLGTIEDVFHFDIAVEQSK........... 155
36 -36.500IDP95445 set236a-047 [Undefined organism]  ali follow..  16  17.....................................DIDNLKGFLNDTSSFGFIAKENNKIIGFAYCYTLLRPDGKTMFYLSIGMLPNYQDKGYGSKLLSFIKEYSKEI-GCSEMFLITDKGNPRACHVYEKLGGKNDYKDEIVYVYDYEKGDK....... 134
37 -36.500IDP95403 set236a-005 [Undefined organism]  ali follow..  16  2..SLDVHQLSPNEVALMETLLATFGENDMETYTGNRPRGAYSRRLLESDYFIALAALEYGEIVGGLAAYELKKFEQERSEIYDLAVAKAHRRRGIATALIEKLKELGAAR-GAYVIFVQTAIEDEPAIALYSKLGVREEVLHFDIPVSQNN........... 155
38 -36.300IDP95401 set236a-066 [Undefined organism]  ali follow..  15  6.NEICIRTLIDDDFPLMLKWLTDERVLEFYGGRDKKYTLESLKKHYTEDEVFRVIIEYNNVPIGYGQIYKMYPKTDEIVYGMDQFIGPNYWSKGIGTRYIKLIFEFLKKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHELHEGKKEDCYLMEYRY 179
39 -36.100IDP95253 acetyltransferase [Acinetobacter baumannii ATCC 17978] YP_001084790 [Acinetobacter baumannii ATCC 17978]  ali follow..  15  2................LEDSVNNGASIGFLAPIEKNEVLNYWREVNHQGNSRLWIAIQEGTVVGSVQLSLVSKKNGVHRAEVKLMVLTSARKQGIATLLLNELENFSKEK-GLRLLVLDTREGD-VSELLYSKIGFVRVGVIPNFALSNGNYDGTAIYYK.. 148
40 -36.100IDP91190 6`-aminoglycoside N-acetyltransferase [Enterococcus faecalis V583] EF_A0061 [Enterococcus faecalis V583]  ali follow..  15  6.NEICIRTLIDDDFPLMLKWLTDERVLEFYGGRDKKYTLESLKKHYTEDEVFRVIIEYNNVPIGYGQIYKMYPKTDEIVYGMDQFIGPNYWSKGIGTRYIKLIFEFLKKERNANAVILDPHKNNPRAIRAYQKSGFRIIEDLPEHELHEGKKEDCYLMEYRY 179
41 -35.600IDP92642 gene: rimI; ribosomal-protein-S18-alanine N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4373 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  23  2...NTISSLETTDLPAAYHI----EQRAHAFPWSEKTFASNQGE-----RYLNFQLTQNGKMAAFAITQV-----LDEATLFNIAVDPDYQRQGLGRALLEHLIDELEKR-GVATLWLEVRASNAAAIALYESLGFNEATIRRNYYPTTDGREDAIIMAL.. 144
42 -35.200IDP02595 acetyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT1384c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  18  1...MKIREATAKDFDDVVYIWSEHLLNNCQFFTTNNQGKLVVEKYLNNPAFKSFVLTVEDQVIGFSCIKDNEIL--------FSTVEQRFLGKGFRSFMLKYLLE------NYAVDTTYVYSANIQTLAFYTSIGFIIEDKIDDI................. 131
43 -35.000IDP95409 set236a-011 [Undefined organism]  ali follow..  12  7..ALHSSRQYNTPLEIVE----RNKNLLVPILHDADEDDVRIASAIVDMANISYAAYIGDECVGAAMMHWQL----DESEILYIAIRAADRGKGYGRELIAAIVNMARER-STQALVVGTASTSVDNILFYQKCGFRMDSVRKDFVYEHGQLRDMVMLRY.. 164
44 -35.000IDP95438 set236a-040 [Undefined organism]  ali follow..  13  1....MLKIAEKEDVPVAAELAGMLWPHH-----SREELEGELLSFIESGGMV-FLWMEEGNPVAFAQCGIRTDYVEGTHGG-GIFVLEKFRRRGIGKVLLTACEEWAKEQ-GCEEFASDTELDNAEGLSFHSGAGFYEANR..................... 135
45 -33.900IDP95034 aminoglycoside acetyltransferase [Corynebacterium striatum]  ali follow..  16  3.TTNEIRVAEVADAGVVAKLLRDFNTEFDT---VPEGLEERFAQIIAHDDAFVLLA----GDIGFAYVTLRPSPYYDGPVAMELYVAPAHRNRGVGTALLQRVFEEIRKH-SAGELQINVDEVDTDARRFYERHGLT......................... 133
46 -33.700IDP92643 gene: rffC; TDP-fucosamine acetyltransferase [Escherichia coli K12] b3790 [Escherichia coli K-12]  ali follow..  16  38.SDSGAVVAQETDIPALRQLASAAFAQSRFRAPWYAPDAQWIENAVRGDHQCLILRAASGDIRGYVSLRELNAT---------DARIGLLAGRGAGAELMQTALNWAYAR-GKTTLRVATQMGNTAALKRYIQSGANVESTAY................... 177
47 -33.100IDP92633 gene: yafP; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b0234 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  20  1MNNIQIRNYQPGDFQQLCAIFIRAVTMTASQHYSPQQISAWAQIDESRAKSQVWVAIINAQPVGFISRIEHYIDM--------LFVDPEYTRRGVASALLKPLIK------SESELTVDA---SITAKPFFERYGFQTVK--QQRVECRGAWFTNFYMRY.. 146
48 -33.000IDP92646 gene: yjaB; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4012 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  17  3...ISIRRSRHEEGEELVAIWCRSVDATDFLSAEYRTELEDLVRSFLPEAPLWVAVNERDQPVGFMLLSGQHMD--------ALFIDPDVRGCGVGRVLVEHALS------MAPELTTNVNEQNEQAVGFYKKVGFKVTGRSEVD................. 131
49 -32.700IDP00230 putative acetyltransferase YPO3444 [Yersinia pestis CO92]  ali follow..  15  7.IRLLVRPITAGDNLAIANVSAEFGLTADKGYTVSDPNLDHLYELYSQPRSAYWVIEVDGHIAGGGGVAPLLGGEADLCELQKMYFLPILRGKGLAKQLALQALAFARQ-QGFGRCYLETTASLTSAVGLYERLGFEH........................ 146
50 -32.200IDP92644 gene: yjgM; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4256 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  18  6PQSPVMRRLTLQDNPAIARVSAEYGLTADKGYTVADPNLDELYQVYSQPGHAYWVVEYEGEVVGGGGIAPLTGSESDICELQKMYFLPAIRGKGLAKKLALMAMEQARE-MGFKRCYLETTAFLKEAIALYEHLGFEH........................ 146
51 -31.600IDP95422 set236a-024 [Undefined organism]  ali follow..  15  52.TNIEIVNFSSELRTHFERLNRGIERQFEMEPLDYLLLQNPETEIIEKGGAVLFAVASRGEVVGTAALKNEG----EGVYELSMAVDEESRGLGIGKALGLAALDRVRK-MGAVKVILYTNSALEPAINLYRKLGFIDVPVTEKGYTRADVKMEIEF..... 204
52 -30.900IDP91382 histone acetyltransferase HPA2 [Vibrio vulnificus CMCP6] VV1_1470 [Vibrio vulnificus CMCP6]  ali follow..  16  1MSDFVLRPITVEDNASIANVIRQVSAEYGLTADKADPTLDDLFSIYSQANAAYWVVEHQGKIVGGGGFS--ALAGVEGVCELQMYFLPICRGQGLAKKIVSLSRSAAKK-MGYQRCYLETTACLKEAIALYEKLGFEH........................ 143
53 -30.800IDP92637 gene: yiaC; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b3550 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  21  1....MIREAQRSELPAILELWLESTTWGHPF-IKANYWRDCIPLVRDAANAQNWVWEEDGKLLGFVSIMEGRF---------AMFVAPKAVRRGIGKALMQYVQQ------RHPHLMLEVYQKNQPAINFYQAQGFHIVDCAWQ.................. 128
54 -29.400CPX_01616_91817 Complex of sperminidine SpeG and DNA-binding response regulator RcsB [Undefined organism]  ali follow..  20  3.SQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDEYNKHIHDNAERRFVVEDAQKNLIGLVELI--EINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQ 165
55 -26.000IDP05291 putative acetyltransferase [Clostridium difficile 630] CD1211 [Peptoclostridium difficile 630]  ali follow..  16  7.QNITLQFVEEKDLENLENVKLLFTEYSNSLNIDFNNELKTLPGKYKKPSGSLILAFVDENLAGCVALKKLE----GKICEL-LYVRNQFRGLKIGKILLEEIIEEAKK-FGYTHMRLDTLPSMKSAQGLYEKFGFYD........................ 144
56 -23.800IDP95421 set236a-023 [Undefined organism]  ali follow..  15  1....................MTELSAELAALYEVADGSAGFKASDVEVPRAAFVIARIDGFPVGCGALRPLD----ASTGEVRMYTRRGFRRKGVAQAILAELERLAIE-FGYTTIKLQTGPKQLDAAALYELVGYHR........................ 114
57 -23.500IDP95397 set236a-062 [Undefined organism]  ali follow..  24  3......................................................................................EVDYWSKGIGTKYTKMIFEFLKKERNADAVILDPHQDNPRAIRMYQKAGFRIIEDLPEHELHEGKKEDCYLME... 75
58 -23.100IDP92634 gene: yedL; predicted acyltransferase [Escherichia coli str. K-12 substr. MG1655] b1932 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  15  1MFTIKTDDLTHPAVQALVAYHISGMLQQ----SPPESSHALDVQKLRNPTVTFWSVWEGEQLAGIGALKLLD----DKHGELSMRTAPNYLRRGVASLILRHILQVAQD-RCLHRLSLETQAGFTACHQLYLKHGFAD........................ 132
59 -23.100IDP91819 gene: yjhQ; KpLE2 phage-like element; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b4307 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  16  3VHHFTFHITDKSDASDIREVETRA--------FGFSKEADLVASLLEDESALSLLARYEGKAVGHILFTRATFKGEMDSPLM-LAVIPEYQGMGVGGRLIRTGIEHLRL-MGCQTVFV----------TYYPRHGFE......................... 131
60 -22.500IDP95424 set236a-026 [Undefined organism]  ali follow..  13  7.................................DFETEVATLPGKYAEPRGRLLLAYVDQKPAGCIALRGID----DGVCEMRLFVRDEFRGHRLGLLLVEKVIGEARA-AGYLKMRLDTFPPKGKAVKLYESHGFREIAPYYNNPHTGVLFMELDL..... 127
61 -21.800IDP92635 gene: elaA; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b2267 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  1MIEWQDLHHSELSVSQLYALLQ---LRCAVFVVEQNCPYQDIDGDDLTGDNRHILGWKNDELVAYARILKSDDD--LEPVVIGVIVSEALRGEKVGQQLMSKTLETCTHHWPDKPVYLGA---QAHLQNFYQSFGFIPVT...................... 133
62 -20.500IDP00844 acetyltransferase, GNAT family SACOL0519 [Staphylococcus aureus subsp. aureus COL]  ali follow..  10  2..QIYLSTLTELDYDKSLNSIEESFDDNPETSWQARAKVKHLRKSPCYNFELEVIAKNENDVVGHVLLIEVEINSDDKTYYG-LSVHPELRGQKLGRGLVQAVEERAKA-QEYSTVVV----------DYFEKLGYQ......................... 134
63 -20.200IDP00739 acetyltransferase, GNAT family SACOL1063 [Staphylococcus aureus subsp. aureus COL]  ali follow..  13  1...MFSKVNNQKMLEDCFYIRKKVFVEEQGVPEESEIDEY-------ESESIHLIGYDNGQPVATARIRPINETTVK------VAVMKSHRGQGMGRMLMQAVESLAKDE-GFYVATMNA---QCHAIPFYESLNFKMRG...................... 123
64 -20.100IDP92638 gene: yiiD; predicted acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b3888 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  15IAMYHLRVPQEEELERYYQFRWEMLRKPLHQPKGSERDA------WDAMAHHQMVVDEQGNLVAVGRLYINA----DNEASIRMAVHPDVQDKGLGTLMAMTLESVARQE-GVKRVTCSA---REDAVEFFAKLGFVNQG...................... 142
65 -19.900IDP91818 gene: yfiQ; inhibiting acetyltransferase for acetyl-CoA synthetase [Escherichia coli str. K-12 substr. MG1655] b2584 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  16  724.ERCLFRPILPEDEPQLQQFISRVTKEDLYYRYFSEINEFTHEDLADYDREMAFVAVRREEILGVTRAISDP----NIDAEFAVLVRSDLKGLGLGRRLMEKLITYTRDH-GLQRLNGITMPNNRGMVALARKLGFNVDIQLEEGIVG.............. 875
66 -19.300IDP92639 gene: yhbS; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b3156 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  1...MLIRVEIPIDAPGIDALLRRS--------FESDAEAKLVHDLREDLTLGLVATDDEGQVIGYVAFSPVDVQGEDLQWVG-LAVDEKYRGQGLARQLVYEGLDSLNE-FGYAAVVT----------ALYSRFGFE......................... 123
67 -18.600IDP95423 set236a-025 [Undefined organism]  ali follow..  13  1MTEVVYTKRSRIDLDLVHSFLSNSYWARNIPREVVRRSVE---------NSLCFGVYEGVAQVGFARVLP---DIATFAYLADVFILESHRGRGLSKWLVESILGHP-DLQGLRRWMLAT----RDAHGLYSKSGFV......................... 128
68 -15.100IDP95449 set236a-051 [Undefined organism]  ali follow..  10  5.KRVSFRPMSEDDLVLMLKWLTDDRVLEFY-KKHTQKTIREHYTEQWADEIYRVIIEYDTIPIGYAQIYRIQGELFDEYD.................................................................................. 86
69 -11.300IDP92630 gene: argA; fused acetylglutamate kinase homolog (inactive)/amino acid N-acetyltransferase [Escherichia coli str. K-12 substr. MG1655] b2818 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  14  298.....IRRATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKF--------TIIQRDNTTIACAALYPFPEEKIGEMACV--AVHPDYRSSSRGEVLLERIAAQAKQ-SGLSKL----FVLTTRSIHWFQERGFTPVDIESKKQLYNYQRKSKVLMADL. 442
70 -11.000IDP90696 gene: argA; N-acetylglutamate synthase [Yersinia pestis CO92] YPO1022 [Yersinia pestis CO92]  ali follow..  13  297.....VRRATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKF--------TIIERDNLTIACAALYPFPDEHIGEMACV--AVHPDYRSSSRGEMLLNRITNQARQ-MGLKKL----FVLTTRSIHWFQERGFTPAEVIQKQELYNYQRRSKILLADL. 441
71 -10.800IDP92641 gene: yjdJ; predicted acyltransferase with acyl-CoA N-acyltransferase domain [Escherichia coli str. K-12 substr. MG1655] b4127 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  17  4..............................................REGHNKFYINDKQGKQIAEIVFVPTGENLAEHT-----DVDESLKGQGIGKQLVAKVVEKM----------------RREKRKIIPLCPFA-----KHEFDKTREYDDIR...... 89
72 -10.300IDP92022 glycylpeptide N-tetradecanoyltransferase, putative [Toxoplasma gondii ME49] TGME49_009160 [Toxoplasma gondii ME49]  ali follow..  12  126...CECDVRDPEELKEVYDLLSQHYVEDDDNLFRFNYSADFLDWALTAPGVIGVRVSSTNKLVGFITATPSQIRVFSDSVPMALCVHKKLRSKRLAPVLIKEITRRVNL----RSIWQAVYTAGVVLPTPVAQCRY.......................... 263

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 7 9 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.