current user: public

If you have questions about the server, please let us know.

Query: IDP91839 gene: mutR; positive transcriptional regulator [Streptococcus pyogenes NZ131] Spy49_0415 [Streptococcus pyogenes NZ131], from CSGID

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MEKELGKTLRRLRKGKQVSISFLADEYLSKSQISRFERGESEITCSRLLNLLDKLNITIDEFVSAHSKTHTHFFTLLSQARKCYAEKNVVKLTKLLKDYAHKDYERTMIKAILFSIDSSIAPSQEELTRLTDYLFKVEQWGYYEIILLGNCSRFMNYNTLFLLTKEMVASFAYSEQNKTNKMLVTQLSINCLIISIDHSCFEHSRYLINKIDLLLRDELNFYEKTVFLYVHGYYKLKQEEMSGEEDMRQALQIFKYLGEDSLYYSYKEHYRQIVLGGKGDEDWSEADLLast
1 -92.900IDP91839 gene: mutR; positive transcriptional regulator [Streptococcus pyogenes NZ131] Spy49_0415 [Streptococcus pyogenes NZ131]  ali  100  1MEKELGKTLRRLRKGKQVSISFLADEYLSKSQISRFERGESEITCSRLLNLLDKLNITIDEFVSAHSKTHTHFFTLLSQARKCYAEKNVVKLTKLLKDYAHKDYERTMIKAILFSIDSSIAPSQEELTRLTDYLFKVEQWGYYEIILLGNCSRFMNYNTLFLLTKEMVASFAYSEQNKTNKMLVTQLSINCLIISIDHSCFEHSRYLINKIDLLLRDELNFYEKTVFLYVHGYYKLKQEEMSGEEDMRQALQIFKYLGEDSLYYSYKEHYRQIVLGGKGDEDWSEADL 288
2 -84.700IDP91844 Rgg/GadR/MutR family transcriptional regulator [Streptococcus agalactiae A909] SAK_1520 [Streptococcus agalactiae A909]  ali follow..  79  1MEKELGKTLRRLRKGKKVSISSLADEHLSKSQISRFERGESEITCSRLLNILDKLNITIDEFVSIHSKAHTHFFILLNRVRKYCAEKNVTKLVALLEDHNHKDYEKIMIKALIFSIDQSIEPNQEELARLTDYLFTVEQWGYYEIILLGNCSRLINYNTLFLLTKEMVNSFAYSEQNKTNKILVTQLAINCLIISIDHSYFEHSHYLIDKVRSLLQDEVNFYEKTVFLYVTGYYHLKLGDSSGKEDMRKALQIFKYLGEDSFYNTYNEHYCQKVLGNNKE........ 281
3 -84.600IDP91840 positive regulator [Streptococcus pyogenes NZ131] Spy49_0449c [Streptococcus pyogenes NZ131]  ali follow..  51  1MKSKLGATLRKVRKGKQISLCFVADEHLSKSQISRFERGESEISCIRLINILDKLHITLDEFLILHDEDYTNSETFANLVQYIRKQYSSQNINNIACLLSDTSFEKTMVKSILHTMDSSIIPSDDELLQLTDYLFKVEKWGYYEILLLGNCVRTINYNSYFLLTKEMLNNYIYSSRNKTNKRIVTQLAINCFILSINKEEFSNCSYLIDEIKTLLDNELNFYEQTVFLYATGYFEFKRLLETGVEKMKQAIQVLDILNEDKLKLHYADHFDKLVNKD........... 283
4 -82.400IDP91845 gene: mutR; putative positive transcriptional regulator MutR [Streptococcus pneumoniae R6] spr0960 [Streptococcus pneumoniae R6]  ali follow..  52  1MKSKLGVTLRKIRKGKQISLCSVADEHLSKSQISRFERGESEISCIRLINILDKLHITLDEFLILHDEDYTKTESFANLVQYIRKQYSSQSINNIACLLSDTSFEKTMVKSILHTMDSNIIPSDEELLHLTDYLFKIEKWGYYEIILLGNCVRTINYNSYFLLTKEMLNNYIYSSLNKTNKQIVSQLAINCFILSIDKEEFSNCSYLISKIKTLLDNELNFYEQTVFLYATGYFEFKRCQTSGIEKMKQAIQVFDILGENKLKLHYTDHFNKPVNKK........... 284
5 -79.300IDP91849 XRE family transcriptional regulator [Streptococcus thermophilus LMD-9] STER_1358 [Streptococcus thermophilus LMD-9]  ali follow..  27  2..KKFGEIFKKFRESRGLRLKDVAKAGISTSQLSRFEKGETDLTISKFMFILDEINMPIDEFMYAVHDFHRDENELLSKVRHFVSTRDVEGMKKLLYSQMELEDRRILLKIRLQDLSGETYYTKDDLTYLTDYLFSVEYWGYYELLIFSNTLDVLNHDVFMVLAREMFRRSDFYKEIPNNRRLISTMLLNGYITCVEREKFMDALYFEKQLNQCFFIETEVYERLVFKYAQNLYQYKEDGVKAIIEMKKCVGAMKLAGSHHLAKTYEGHLEKILASS........... 286
6 -79.300IDP91851 XRE family transcriptional regulator [Streptococcus dysgalactiae subsp. equisimilis GGS_124] SDEG_1013 [Streptococcus dysgalactiae subsp. equisimilis GGS_124]  ali follow..  25  2..KNFGEIFKKFRESRGLKLKDIAKAGISTSQLSRFEKGETDLTVSKFMLILDEINMPIDEFMYAVHDFRRDDNELLLKVRHFVSTRDIEGMKKLLYSQMESENKRILLKIRLQDLSGENYYDKKDLDDLTDYLFSVEYWGYYELLIFMNTLDVLNHDVFMVLAREMSRRSDFYKEIPNNRRLISTMLLNAYITCIEREKFIDALYFEKLLNQCFFIETEIYERLVFKYAQNLYLYKKERSNAVTEMKNCITAILLAGSNSLAKTYEGHLKKTLAEDSQQAYTGKK.. 295
7 -78.900IDP91848 XRE family transcriptional regulator [Streptococcus thermophilus LMD-9] STER_1530 [Streptococcus thermophilus LMD-9]  ali follow..  28  2..KEFGAIFKKFRKSRGIRLKDVAKAGISTSQLSRFEKGQTDLTITKFMLILDEINMPIDEFMYAVHDFHRDDLNLLSKIRLFVSTHDIDGLKKLLSSQLESEPKRILLKIRLQDLSGESYYTQQDLADLTDYLFSVEYWGYYELLIFANTLDVLNHETLMVLAKEMSRRSDFYKEIPNNRRMISTMLLNVYITCIEREELIDALYFEKQLNQCFFIETEIYERLVFQYAQNYYQYKKEGNQSIIEMKKYIGAMKLAGSEHIAKTYEAHLKKLIEENS.......... 287
8 -78.800IDP91853 transcriptional regulator [Streptococcus equi subsp. zooepidemicus] SZO_17730 [Streptococcus equi subsp. zooepidemicus]  ali follow..  27  2..KNFGEIFKKFRESRGLKLKDVAKAGISTSQLSRFEKGETDLTISKFMLILDEINMPIDEFMYAVHDFHRDENELLSKVRHFVSNHDVDGLKKLLYSQMESNPKQILLKIRLQDLSGEAYYSSGDLSYLTDSLFSVEYWGYYELLIFSNTLDVLKHDVFMVLAREMSRRSDFYKEIPNNRRLISSMLLNGYITCVERGKFLDALYFEKQLNQCFFTETEIYERLVFQYAQHLYHYKKEKCKAIIEMRKCIAAMKLAGSNHLSKTYEGHLEKVLAEKS.......... 287
9 -78.700IDP91852 DNA-binding protein [Streptococcus equi subsp. zooepidemicus] SZO_12400 [Streptococcus equi subsp. zooepidemicus]  ali follow..  27  3VLNHFGKLFKKFRESRGLLLKDVAKAGISTSQLSRFENGETDLTISKFMSALDEINMPIDEFMYAVHDFHRDENELLSKVRHFVSTRDVEGMKKLLYSQMESENKRILLKIRLQELSGETCYSDHDLSYLTDYLFSVEYWGYYELLIFSNTLDVLKHDVFMVLAREMSRRSDFYREIPNNRRLISTMLLNAYITCIGQGELIDALYFEKQLNQCFFIETEVYERLVFQYAHHLYKYKKTGCKAIIEMKKCIAAMTLAGSNHLAKTYEGHLKKIIASK........... 289
10 -78.700IDP91842 positive transcriptional regulator MutRfamily [Streptococcus pneumoniae G54] SPG_1268 [Streptococcus pneumoniae G54]  ali follow..  31  1..MILGETYRKIREEKGISISSLAGAEISKSQISRFELGETEISVFKLLYLLERIGVTLEEFLLICNHYQPSDNTLIASVKQAAYNEDTQTLLDMVEKEMELFRGTIFIESIVSGMDKNHQLSRQDASYLTNYLFSVENWGYYETLILGNCCRVLSPDLLFRYTKEALKKGKLYSPIPRNRQSLIQLLLNSLIIMIENDLYEESLFLKQATKNILADSTDFFEQTILLYLDGYLELKFYHQKSLLKIKEALKIFELFNKTIYKNYKQYFEKHIIHLVD.......... 287
11 -78.000IDP91854 transcriptional regulator [Streptococcus pneumoniae TIGR4] SP_0141 [Streptococcus pneumoniae TIGR4]  ali follow..  20  3ERMELGEFYKELRLARKLKQSDVACEGLTASQLSKFELGQSMLSADKLILAIQGINVTFDEFGHKLNNYQESHMRIGRKVVNRFAHQDIAALEQLLEEVDQEQMAQIVIKDAIHSLNKSYPLAEEDSEFLTTYLYAIESWTWFELYLFCNTMPFLSNQDLIFLSTSLLEKSKEFKELVHNRLYMKQGLLNILSELMERKLFSYIPIFEAELERMLRPYD-VFEKVSWQFLKKMSVFLQTKGSNQKEIERFIQSLQVLENPQLIALFELRFQQYKELID.......... 287
12 -77.800IDP91855 XRE family transcriptional regulator [Streptococcus thermophilus LMD-9] STER_1299 [Streptococcus thermophilus LMD-9]  ali follow..  21  5ELLKLGEFYKELRIARKVKQKDVAKNKLSVSQLSKFESGQTMLSADKMLEVIEGINLTFSEFGFALRDYKPTQHQLMNKISKLSAENDKQSLLKLLDKYKESQLLYDKLNTLVIKIDRDFTLSLDDSKFLSNYLFDIEDWTAYEIHLFGNTMPFLSDTDLLFLGKELVSRSEIYSPLLDFRKALKYTYLNLISELVERRLTTHFNFFVNQLRMI-LDVFDTFEIILLNFLVLVYSYLIENSVNLEEVEQYILKVSEIEQLGLSKILEQRLSQYLRTNQKGER...... 291
13 -77.500IDP91846 DNA-binding protein [Streptococcus suis P1/7] SSU1789 [Streptococcus suis P1/7]  ali follow..  28  2..SCFGKTLKFIREGKGKSLAEVAKGHISTSQLSRFENGESDITVSKLFGVLAEMNVDVDEFVYASQDFKKDETRILEQLKQSIYIRDVVTIKKILSEQLAKAERDILIAYKLRNLDKTIVVSKEDTAFLTDYLFRVENWSYYEILLFANTIDKLGHQTMMLFCRELIHRTQFYREMKQHRLVVSQVLLSAYLVSVQTKELVDAIFLEKTIEGLLFDETEIFERILFKFGKAFYDYQNTGSNAILEMRKCIGLLRAVDSQNIADWYESILEKILIE............ 287
14 -77.300IDP91843 positive transcriptional regulator, MutR family [Streptococcus equi subsp. zooepidemicus MGCS10565] Sez_0050 [Streptococcus equi subsp. zooepidemicus MGCS10565]  ali follow..  32  1..MILGETYRKMREEKGISISSLAGYEISKSQISRFELGETEISIFKLLYLLEKIGITFEEFLLACNNYEPSENTLIKAVQNSAYNNKVETLISMIEQENKLFEETIFIQSIISELDNNHQLTNQDISYLSNYLFSVENWGYYETLILGNCCRSLPPKLLFKYTKEALKKGTLYNSIPRNKQSLIQLLLNSLLLMIENDFYEEAIFLNQASKNLLSNSTYFFELTILLYLEGYLELKFNIEKSNSKIEEALKIFNSLNKTIYQNYQEHFNKYISN............. 285
15 -77.200IDP91847 XRE family transcriptional regulator [Streptococcus thermophilus LMD-9] STER_0934 [Streptococcus thermophilus LMD-9]  ali follow..  27  2..KDYGKLFKKFRESRGLVLKDIAKLGVSVSHISRFERENTDLTISKFMSALNAINMPIDEFMYAANDFQRDEFNILEKISLFVSARNVSGMEKLLISQVEKIEKRILIKIRLQDLSDKSYYDESDIQYLSDYLFSVEYWGCYELLLFANTVDVLNHQTMMLLSREMCKRSEFYKDLPNYRRLHSTMLLNCYIISIERDEYIDALYFEKQLNHSCFTETEIYEKLVFHYSKNLYELKKNRNKAILEMKKCITAMKLANSENLAIKFENHLSGVLK............. 284
16 -76.900IDP91850 gene: rgg; putative transcriptional regulator [Streptococcus mutans UA159] SMU.1509 [Streptococcus mutans UA159]  ali follow..  28  2..TEYGKIFKKFRESRGLKMKEVAGSNLSTSHLSRFENGESELTISKLMTALYKINMPIEEFMYAANDFHQDENELLKDVRECVNNKDVERLKAVLIKQQENLKEGILVKIRLQDLSGETYYSKADLDYLTNYLFKVEYWGFYELLLFTNTIDVFKHETFMVLSREMMRRSDFYKEIPRNRRLISRMALNSFITCIERDKLIDALYFEKQLSICHFDETEIYERLVFHYAQNLFAYKKYKTFAIIEMKKSVAAMKLAGSLHIAETYENHLQKILEG............ 285
17 -76.800IDP91856 MutR [Streptococcus pneumoniae Hungary19A-6] SPH_0253 [Streptococcus pneumoniae Hungary19A-6]  ali follow..  20  3EKMELGEFYKELRLARKLKQSDVACAGLTASQLSKFELGQSMLSADKLILAIQGINVTFDEFGHKLNNYQESHMRIGRKVVNRFAHQDIAALEQLLEEVDQEQMAQIVIKDAIHSLNKSYPLAEEDSEFLTTYLYAIESWTWFELYLFCNTMPFLSNQDLIFLSTSLLEKSKEFKELVHNRLYMKQGLLNILSELMERKLFSYIPIFEAELERMLRPYD-VFEKVSWQFLKKMSVFLQTKGSNQKEIERFIQSLQVLENPQLTSLFELRFQQYKELID.......... 287
18 -76.800IDP91857 MutR [Streptococcus pneumoniae P1031] SPP_0211 [Streptococcus pneumoniae P1031]  ali follow..  20  3EKMELGEFYKELRLARKLKQSDVACAGLTASQLSKFELGQSMLSADKLILAIQGINMNFDEFGHKLNNYQESHMRIGRRVVDCFSHQDIAALEQLLEEVDQEQMAQIVIKNALHSLDKSYPLTEEDSEFLTTYLYAIESWTWFELYLFCNTMPFLSNQDLIFLSTSLLEKSKEFKELVHNRWYMKSGYLNIISELMERKLFSYIPIFEAELERMLRPYD-VFEKVLWQFLKKMQIFLQTKGSNQKEIEHFIQSLQVLENPQLTALFELRLQQYKELID.......... 287
19 -53.900IDP91841 MutR family transcriptional regulator [Streptococcus thermophilus LMG 18311] stu0182 [Streptococcus thermophilus LMG 18311]  ali follow..  33  1............................................MIKFLSALDFINVSIEEFMVIYRGYRDSFEELLKKLHTLSLTKDAEGLRYLFNEVEELPNSTILILSCLSSVESENLITQSDLRFVTDYLFGIESWGYYELSILGNLAQYINGETLVSLGREVLRKTDYYYEVVRNSKLVIQLSINIMIRCIESEWFTKAAFFERHIDSLVNVESDMYEKVIFSYVQGYLKFAMGDSGGKQIMQESLEIFKLLKNTRLYKNYLEHFKSIVG............. 238
20 -49.900IDP91866 hypothetical protein SPy_0037 [Streptococcus pyogenes M1 GAS] SPy_0037 [Streptococcus pyogenes M1 GAS]  ali follow..  12  1MLEHFGGKVKVLRLEKRISREDLCGDELSVRQLARIELGQSIPSLSKVIFIAKALNVSVGYLTDGADLELKRYKELKYLILRTPTYMDDGKLQVREEQFDEKIIIDCLQATLDTLLSENTNFGIDLLQEYFNQIKTKVRFRQNDLILLELYLAYLDIEGMDGQYSDKIFYDSLLDNLLDELFIVNKIIIDISSLSLKNNRLDNLEKAIEMSQKIMAKIQDWNRMPILKLIEWKYFLIKDIIKAEQSFMKACLFAQMTADQYLENKLIQEWEKDVKS............ 302
21 -49.500IDP91832 putative transcriptional regulator [Streptococcus mutans UA159] SMU.61 [Streptococcus mutans UA159]  ali follow..  12  1MLKDFGKKIKSLRLEKGLTKEAVCESQLSTRQLTRIESGQSTPTLNKAVYIAGRLGVTLGYLTDGENVELPSRKELKYLLLRTPTYGDQQRLAEKETYFDEQLIIDGLQSKLDIHFSDNIDFGVGILNDYFDQILRKTNYQVNDLILIDLYFSCLTVSGLDSAIFDSRKYNQLLETLLKQVDVLNNVLLNNFGLLLELKKYDFVKQLIAVSNKIMDRTHDFQKKPIVNLLTWKHHLFVDYAEAKKSYDAAILFAQLTENINLRENLEKEWQKDSQN............ 302
22 -47.700IDP91859 DNA-binding protein [Streptococcus agalactiae A909] SAK_0081 [Streptococcus agalactiae A909]  ali follow..  14  1MLKHFGSKVRKFRESQQVTREEFCGDELSVRQLARIEAGESVPNLSKAHYIARNLGVSLDSLTAGASLELSKKKELKYLILRTPTYNDTDRLDLIEKYLDEKIAIESIQSSLDIYISKSHHFGDDLIREYMNQIKRKKIYSINDLLIIKLWQYKITASRYDPNIFKIDTFIGTIDKLLNQVKLLRDVLIYSLGILFILAEYQQIENIINTLNDILIKTQDFQKRPIIDMFEWKYQLFYNREVAKRKYQESTLFAQLIGDQVLVTQLKEEWKADYIE............ 302
23 -46.700IDP91861 transcriptional regulator [Streptococcus dysgalactiae subsp. equisimilis GGS_124] SDEG_0056 [Streptococcus dysgalactiae subsp. equisimilis GGS_124]  ali follow..  13  1MLEHFGEKVRGLRLEKGISREELCGDELSVRQLARIELGQSIPSLAKVIFIAKALEVSVGYLTDGANLELPKRKELKYLILRTPTYMDDRKLQVRESQFDEQLIIECLQATLDTLLSENINFGVELLQEYFKQTKVKLRFKQNDLILIELYLAYLDIEGMYGEYSDKVFYDSLLDNLLDELFIVNKIIIDISSLSIKTNKLDNLEKTIAISQKIMAKIQDWNRMPILKLIEWKYFLIKNRKQAEESYTKACLFAQITGDKYLEEQLIKEWEKDICA............ 302
24 -45.400IDP91862 DNA-binding protein [Streptococcus equi subsp. zooepidemicus] SZO_00390 [Streptococcus equi subsp. zooepidemicus]  ali follow..  13  1MLDNFGEKVRDLRYQKKITREDLCGSELSIRQLARIELGQSIPSLSKVVFIAKALDVSVGFLTDGEDLELKELKYLILRTPTYMDDDKLKLREEQFNEIFEDYYDQLPEEEKLVLLTENINFGVGLLQEYFEQTKSKTQFRENDIELYLAYLDIAGMNGEYSDKGFYDSLLDILLNELEELFIVNKIAIGISSLSIKNNKPEILEKVIVLSQKIILKTQDFNRMPILNLIEWKYALMKDIEMAKKCYDKACLFAQLTGDQYLEKKLREEWGKDIKRYQ.......... 304
25 -44.800IDP91865 DNA-binding protein [Streptococcus pyogenes str. Manfredo] SpyM50034 [Streptococcus pyogenes str. Manfredo]  ali follow..  11  1MLEHFGGKVKVLRLEKRISREDLCGDELSVRQLARIELGQSIPSLSKVIFIAKALNVSVGYLTDGADLELPKRKYLILRTPTYMDDGKLQVREEQFDEIFEDYYDKLIQAKFEVYQTGDINFGYSILKEFLPQLKRKSIYNLNELLLIDLYLIILVVSHFSDDIFDVQFYEEITESMLKQHNLLNNILLSCADTYIRLKMFGRLKETLQLSHFIMSTIQDFQKMPMYCMYEWKLSIFYDINRARNYFEQSILFTQMTGDTYLVQKLRGEWNKDIHY............ 302
26 -43.400IDP91858 hypothetical protein gbs0048 [Streptococcus agalactiae NEM316] NP_734518 [Streptococcus agalactiae NEM316]  ali follow..  13  1MLKHFGSKVRNLRVTRNITREDFCGD-LSVRQLARIESGQSIPNLTKAHYIAKQLNVKLDILTGGESLELKRYKELKYKLLRTPTYGDANRLAVREAYFDERLIIDCMQSKLDVHFSVNDNFGITILHDYFDQIKKKKEYTTNDFVMIDLYLLCFSINSLENYHFIMSKLLEQDNLLPEDNFQLNNVLLNHVELAFQFKQKKYVQQIIHRSNAIMTEIHDFQKRPILSLIEWKYLLIIDRTKAETCFKQSILFAELIGDLYLKGKLIEEWNKDLT............. 300
27 -42.800IDP91834 DNA-binding helix-turn-helix protein [Streptococcus downei F0415] HMPREF9176_0709 [Streptococcus downei F0415]  ali follow..  14  3FKSKIGPQIRQKREAKQLSREKLCHDGLTVRQLIRIEKGQSLPSLDKLDYIAQQLGLKPSDLLAEEELTIPDTFELKHRLVKFPTYGDPERVGQKQAMIEEAYEKYFTVLILNWSQTKKLVAIEEIYEDAFEQLQEKKIYNLNDLMVLGYYLIGIDKKLFNKLKNRLLEQEPSTDE--LYNIDLLSILISVLGVYVQHGDYGATLPVFKKVYQLIEETQQPSYRPSVMMVEAKYYLNVDKEQAGQLYDQAINFATLLGDQVLADGLREEKDRD............... 297
28 -42.400IDP91838 cro/CI family transcriptional regulator [Streptococcus bovis ATCC 700338] HMPREF9319_0022 [Streptococcus equinus ATCC 700338]  ali follow..  15  2..EKFGIKVRALREKKGISREEFCGDELSVRQLARIEKGQSVPTLNKVGYIAKVLGVTIGELTDGKNLELTRYKELKYLLLRTPTYGDEERLKRQTSYFDERLIIDCLQSKLDVHFSDDVNFGEGILNDYFDQVIRKKNFQINDLVLIDLYFACLGIYSLDLYDKLMECLLDQENLSPETSLILNNVLLNNVDLVLRFHRESFMKRIIIKSDTIMTSVHDFQRRPVLSLVEWKYYLQFKKLAAQKSYSNAILFANLIGDTYLENKLIEEWNNDTT............. 299
29 -42.000IDP91833 DNA-binding protein [Streptococcus suis SC84] SSUSC84_0046 [Streptococcus suis SC84]  ali follow..  14  1MNKEFGQRVRQLRESASMTREQFCDDELSVRQLTRIEAGASKPTFSKIQYIATRLGMGLYELMPDYVSLPERYSKLKFDVLRTPTYGNEDLAEKRDAMMTEKIAIDAIQSRIDTLESGTAGFGKEILEDYFEQIFRKRKYELNDLLIVRLHLEYVIFRQFLKIIEHLHEQINIINS--NDLFVLRDTLLSCVNILGSKKYYEPIPKIFDSVDKIIQSTQDFQKKPIVSVLKWKYALFVDRDEAEKHYLDAVLFAKLIENRELEQKIEEDWRVDNQ............. 299
30 -41.800IDP91860 Cro/CI family transcriptional regulator [Streptococcus agalactiae 2603V/R] SAG0048 [Streptococcus agalactiae 2603V/R]  ali follow..  13  1MLKHFGSKVRNLRVTRNITREDFCGD-LSVRQLARIESGQSIPNLTKAHYIAKQLNVKLDILTGGESLELKRYKELKYLILRIPTYADAERLKLRECQFDHCLAIDSLQAKFEVYQTGDINFGVEVLCECFDKVKYKEKYTLNDLIIIDLFLTCAVVSKFNNRAFTKEVFQTICKTLISQNHWFNHVLLNCVFVGLCLNSEECLAEMLEVSRQTMVSTHDFHKMPLYFMYQWKYFITIDNKSAENAYQQSIMFSKMIDDKHLIKKLELEWQEDITG............ 302
31 -41.700IDP91836 Cro/CI family transcriptional regulator [Streptococcus gallolyticus UCN34] GALLO_0038 [Streptococcus gallolyticus UCN34]  ali follow..  15  2..EKFGIKVRALREKKGISREEFCGDELSVRQLARIEKGQSVPTLNKVGYIAKVLGVTIGELTDGKNLELTRYKELKYLLLRTPTYGDKERLKRQTSYFDERLIIDCLQSKIDVHFSDDVNFGEGILNDYFDQVRRKKNFQINDLILIDLYFACLASAKSFVGIYSLDLYDELMECLLNQENILNNVLLNNVDLVLRFHRESFMKRIIIKSDTIMTSVHDFQRRPVLSLVEWKYYLQFKKLAAQKSYSNAILFANLIGDTYLENKLIEEWNNDTT............. 299
32 -40.500IDP91867 DNA-binding protein [Streptococcus uberis 0140J] SUB0057 [Streptococcus uberis 0140J]  ali follow..  15  2..QGLGLKMKELRKKKQMTREALCGDELSVRQLARIESGQSNPSLAKALFIAKKLGVPLSDFVNPKELDLPKRKYLILRHPTYMNTDSIEERESQFDIIFEDYYADLLRSRFEVYQSGNSVYGQDLLLEYIDQIKKKKTYDLNDIFFIDLYLTCGYVSSFKGIFECFTSKLILLEEKLDFKDLLNNVLMTAIAVGLTLEEYVKIRTLLNVCRRIMTITQDFQRMPIYYMYEWRYTLFHDFRKAPYYYQQSLLFARTHGDEYLKTMIVNAWQEDQDKVKTLESQKE... 310
33 -40.200IDP91835 DNA-binding protein [Streptococcus equinus ATCC 9812] HMPREF0819_1750 [Streptococcus equinus ATCC 9812]  ali follow..  16  2..KKFGNKIRILREKKGISREEFCGD-LSVRQLARIELNQSIPNLSKAQFIANRLGVKLGTLTDGDSLELPKRKYLLLRTPTYGDQERVDRKNDYFDEISENYYDIIPEEEKLIIDSDDVNFGDGILNDYFDQVIRKETFNINDLILIDLYCVCMGIYSLDIYDNLMDCLLNQSHVTPETSLILNNVLLNNIALAFKFEREDYVYKVIKISDRIMTEIHDFQRRPILSLVEWKYYLKFDYDSAKQSFTHATLFARLIGDVYLENKLKEEWKFDTTT............ 300
34 -39.000IDP91863 DNA-binding protein [Streptococcus parauberis KCTC 11537] STP_0036 [Streptococcus parauberis KCTC 11537]  ali follow..  14  2..PELGDKIKAIRLGKKLTRESICGD-LSVRQLVRIEQNQSLPTLAKLVYLAKVLDIRLDKLINPKTISIHDYLALKYQIIRTPLYMNDQVMAIREGQFDAKLIIDFLQSKFDVYQSGDANFGRPLLQDYIRQISKKKRYQINDIFLIDLYLTCAIVSSFKAEFFDLDLYRRFLSKLLLMEKLLNNVLLTCIDVGIRIGHFELIQPALKASHRIMYKVQDFQRLPIYCMHAWKNALFYSVKRGEDYFHQAQLFAKLIGDKNLEGKLAREWQKNLAESEKT........ 305
35 -38.400IDP91864 transcriptional regulator, Cro/CI family [Streptococcus porcinus str. Jelinkova 176] ZP_08398653 [Streptococcus porcinus str. Jelinkova 176]  ali follow..  14  2..KKLGKKIQKLRLDKSLTRETICGDELSIRQLARIEKGQSIPSLAKVLFIAKKLELPVVELINPECLVLPKRKYLILRRPTYMNGQNLVDREAQFDEIFEDYYATLLQSRFDVYQSGDTNYGKELLREYISQIRKKKSYALNDIFLIDLYLTCGMVSNFKEELFDKGNFDCFTNKLVLLEDLLNNVLLTSIAVGISIKEYQKTRILLNVCRRIMTITQDFQRMPIYYMYEWKYTLFYDSQKAYYYYRQSLIFARTLTDNYLVNRLKTSWELDNQS............ 301
36 -38.200IDP91837 hypothetical protein STRINF_00393 [Streptococcus infantarius subsp. infantarius ATCC BAA-102] STRINF_00393 [Streptococcus infantarius subsp. infantarius ATCC BAA-102]  ali follow..  12  2..EKFGEKIRLMREEKEISREEFCGD-LSVRQLARIELNQSIPNLSKASFIANRLGVKLGTLTDGDSLEPKRYKELKYLLLRTPTYGDQVRLDRKNDYFDERLIIDCLQSKFDVHFSEDVNFGEGILNDYFGQVNRKKVFTINDLILIDLYFACLGIYSLDFYDDLMKRLVNQKHVSPETDLILNNVLLNNIDLAFQFKREYYIERVITISEKIMTEIHDFQRRPILSLVEWKYYLKLDFALAEQSFTNATLFARLVGDTYLENKLKEEWQLDIDAVE.......... 302
37 -19.800IDP91375 hypothetical protein VV1_2191 [Vibrio vulnificus CMCP6] VV1_2191 [Vibrio vulnificus CMCP6]  ali follow..  19  9LAEEIGDRLKQARLNRDLTQSEVAEIAIARKTVLNAEKGKVQLDIMIAILMALDLTEQIDLFI................................................................................................................................................................................................................................. 72
38 -18.200IDP00197 putative prophage repressor protein YPO1233 [Yersinia pestis CO92]  ali follow..  21  15..KRLKELFNAKKKALGISQESVAHELVGQSAVNQFLNGVNPLNITNAAAFAKVLNEPISSFS................................................................................................................................................................................................................................. 76
39 -13.400IDP93919 antidote protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001006180 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  23  10.....GGIIAESLEDLALSINAAARALVAPSTLSRVMRGESAISPEMAVKLEAAGIGTARHWLAMQSGYD.......................................................................................................................................................................................................................... 75
40 -10.500IDP02170 helix-turn-helix family protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1010 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  18  1..MAIKIDLAKIMVDKQIKSKDLARAIITEQNLSILKNGKAKIRFSTLEAICKYLECQPGDIL................................................................................................................................................................................................................................. 63
41 -10.500IDP06200 hypothetical protein HP0554 [Helicobacter pylori 26695] NP_207349 [Helicobacter pylori 26695]  ali follow..  14  30.ELSLKNLDKNLQILKEVGVAEICKATIASKNIHSILEKRYEVHARGFIQILERYKIDLSAWMKEFDKA........................................................................................................................................................................................................................... 103
42 -10.400IDP91041 gene: vanUG; predicted transcriptional regulator [Enterococcus faecalis] EFE0002 [Enterococcus faecalis]  ali follow..  18  6......NKLWKLLIDRDMKKGELREAVVSKSTFAKLGKNEN-VSLTVLLAICEYLNCDFGDIIEALPETPDKERD..................................................................................................................................................................................................................... 74

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.